KEGG   Loxodonta africana (African savanna elephant): 100655646
Entry
100655646         CDS       T04351                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01524  Platinum drug resistance
lav04014  Ras signaling pathway
lav04064  NF-kappa B signaling pathway
lav04115  p53 signaling pathway
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04621  NOD-like receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05145  Toxoplasmosis
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05168  Herpes simplex virus 1 infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05212  Pancreatic cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100655646 (BCL2L1)
   04630 JAK-STAT signaling pathway
    100655646 (BCL2L1)
   04064 NF-kappa B signaling pathway
    100655646 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    100655646 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100655646 (BCL2L1)
   04137 Mitophagy - animal
    100655646 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    100655646 (BCL2L1)
   04215 Apoptosis - multiple species
    100655646 (BCL2L1)
   04115 p53 signaling pathway
    100655646 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100655646 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655646 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    100655646 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100655646 (BCL2L1)
   05225 Hepatocellular carcinoma
    100655646 (BCL2L1)
   05220 Chronic myeloid leukemia
    100655646 (BCL2L1)
   05222 Small cell lung cancer
    100655646 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100655646 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    100655646 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    100655646 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100655646 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    100655646 (BCL2L1)
   05162 Measles
    100655646 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    100655646 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100655646 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100655646 (BCL2L1)
   01524 Platinum drug resistance
    100655646 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100655646 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100655646 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100655646 (BCL2L1)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100655646 (BCL2L1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100655646 (BCL2L1)
Transporters [BR:lav02000]
 Other transporters
  Pores ion channels [TC:1]
   100655646 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100655646
NCBI-ProteinID: XP_003411683
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTGASEGTESEMEIPSAINGNPSRHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagttggagtcagtttagtgatgtggaggagaataggactggggcctcggaaggc
actgaatccgagatggagatccccagtgccatcaatggcaacccatcccggcacctggca
gacagccctgcggtgaatggagctactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcagtgaagcaagctctgagggaggcaggcgatgagttcgaactgcgg
taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggctacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacgttcgtggaactctatgggaacaatgcagcg
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggtgtggttctgctgggctccctcttcagtcggaaatga

DBGET integrated database retrieval system