KEGG   Loxodonta africana (African savanna elephant): 100655666
Entry
100655666         CDS       T04351                                 

Gene name
ATP1B3
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-3
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04911  Insulin secretion
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04964  Proximal tubule bicarbonate reclamation
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav04974  Protein digestion and absorption
lav04976  Bile secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100655666 (ATP1B3)
   04022 cGMP-PKG signaling pathway
    100655666 (ATP1B3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100655666 (ATP1B3)
   04918 Thyroid hormone synthesis
    100655666 (ATP1B3)
   04919 Thyroid hormone signaling pathway
    100655666 (ATP1B3)
   04925 Aldosterone synthesis and secretion
    100655666 (ATP1B3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100655666 (ATP1B3)
   04261 Adrenergic signaling in cardiomyocytes
    100655666 (ATP1B3)
  09154 Digestive system
   04970 Salivary secretion
    100655666 (ATP1B3)
   04971 Gastric acid secretion
    100655666 (ATP1B3)
   04972 Pancreatic secretion
    100655666 (ATP1B3)
   04976 Bile secretion
    100655666 (ATP1B3)
   04973 Carbohydrate digestion and absorption
    100655666 (ATP1B3)
   04974 Protein digestion and absorption
    100655666 (ATP1B3)
   04978 Mineral absorption
    100655666 (ATP1B3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100655666 (ATP1B3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100655666 (ATP1B3)
   04964 Proximal tubule bicarbonate reclamation
    100655666 (ATP1B3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100655666 (ATP1B3)
CD molecules [BR:lav04090]
 Proteins
  100655666 (ATP1B3)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 100655666
NCBI-ProteinID: XP_003416271
UniProt: G3T5U7
LinkDB
Position
Unknown
AA seq 279 aa
MTKKDKKSLNQSLAEWKLFLYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWA
MLQTLNDEVPKYRDQIPTPGLMVFPKPVTALEYSFSLSDSSSYEGYIRDLDDFLRPYDLE
EQKNLTACTDGELFVQEGPAYRACQFPRHLLEECSGQNDANYGYSGGNPCVLVKMNRIIG
LKPQGHPRIKCTPKDEQVALVRAYPSQGFIDLKYFPYYGKKLHVGYRQPVVAVQAVFNPN
NTRKEATFDCIIDGSPNLKNKDDRDKFLGRVTFKITVNA
NT seq 840 nt   +upstreamnt  +downstreamnt
atgacgaagaaagacaagaagtccttgaaccagagcctggccgagtggaagctgttcctc
tataacccgaccaccggagagttcctggggcgcaccgccaagagctggggtttgatcttg
ctcttctaccttgtcttctatgggttcttggctgcgctcttctcattcacaatgtgggcc
atgcttcagactctgaatgatgaggtcccaaaatatcgtgaccagattcccactccagga
cttatggtttttccaaaaccagtgactgcgttggaatattcgttcagtttgtctgattca
agttcctatgaaggatacattagagatcttgatgattttctaaggccatacgatttggaa
gagcagaagaatctcacggcctgtaccgatggagaactttttgtacaggagggccctgct
tatagggcgtgtcagtttcctcgtcatttacttgaagagtgcagcggccagaatgatgct
aactatggctattccggaggcaacccttgtgtccttgtgaaaatgaacagaataattgga
ttaaagcctcaaggacacccaaggataaagtgtactccaaaggatgaacaagtggcactt
gtaagagcttatccttcccaaggatttatagacttgaagtattttccatattatggaaaa
aagctgcatgtggggtatcgacagccagtggttgctgttcaggcagtctttaaccctaac
aataccaggaaagaagcaacatttgactgcataattgacggatcacccaacctaaaaaac
aaggatgatcgtgacaagtttttgggacgagttacgttcaaaatcacagtgaatgcatag

KEGG   Loxodonta africana (African savanna elephant): 100660792
Entry
100660792         CDS       T04351                                 

Gene name
ATP1B4
Definition
(RefSeq) protein ATP1B4 isoform X2
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04911  Insulin secretion
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04964  Proximal tubule bicarbonate reclamation
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav04974  Protein digestion and absorption
lav04976  Bile secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100660792 (ATP1B4)
   04022 cGMP-PKG signaling pathway
    100660792 (ATP1B4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100660792 (ATP1B4)
   04918 Thyroid hormone synthesis
    100660792 (ATP1B4)
   04919 Thyroid hormone signaling pathway
    100660792 (ATP1B4)
   04925 Aldosterone synthesis and secretion
    100660792 (ATP1B4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100660792 (ATP1B4)
   04261 Adrenergic signaling in cardiomyocytes
    100660792 (ATP1B4)
  09154 Digestive system
   04970 Salivary secretion
    100660792 (ATP1B4)
   04971 Gastric acid secretion
    100660792 (ATP1B4)
   04972 Pancreatic secretion
    100660792 (ATP1B4)
   04976 Bile secretion
    100660792 (ATP1B4)
   04973 Carbohydrate digestion and absorption
    100660792 (ATP1B4)
   04974 Protein digestion and absorption
    100660792 (ATP1B4)
   04978 Mineral absorption
    100660792 (ATP1B4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100660792 (ATP1B4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100660792 (ATP1B4)
   04964 Proximal tubule bicarbonate reclamation
    100660792 (ATP1B4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100660792 (ATP1B4)
CD molecules [BR:lav04090]
 Proteins
  100660792 (ATP1B4)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 100660792
NCBI-ProteinID: XP_003414817
LinkDB
Position
Unknown
AA seq 346 aa
MRRQHRSRRAPTFPHGYRYRLDDQDEANQNYLADEEEEAEEEARVMGVPNLEEKEKEEEQ
NEEEEGQGQPTGNTWWQKLQLMNEYLWDPEQRMSLARTGLILVIYFFFYASLAAVITVCM
YTLFLTISTYMPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYND
SLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKM
NRIVGFRPELGDPVKVSCKVQRGDENDIRSINYYPESASFDLRYYPYYGKLTHVNYTSPL
VAMHFTDVVKNQVVPVQCQLKGKGIINDVINDHFVGRVIFTLNIET
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgagaaggcagcaccggtccagaagggctccaacctttccccatggctatcgctacaga
cttgatgatcaggatgaagcgaaccagaactacttggcagatgaagaggaggaagcagag
gaagaggctcgggtgatgggggtacccaatttggaggagaaagagaaagaagaggagcaa
aatgaggaggaagagggtcagggtcagccaacaggcaatacctggtggcagaaattgcaa
ctcatgaacgaatacctgtgggatccggagcaaaggatgtctctggcccgaacaggcctg
atcttggtcatttacttcttcttctatgcctctctggctgctgtgataactgtctgcatg
tacacgctatttctgaccatcagtacttacatgccgaccttcactgagagggtgaagcct
cctggagttatgatcagacccttcgcccatagccttaacttcaacttcaacgtctctgaa
cctgacacttggcagcattatgtgattagcctaaatggctttctccagggctataatgac
agtcttcaagaggaaatgaacgtagattgtccaccagggcagtacttcatccaagatggc
aatgaggatgaggacaagaaagcctgccaatttaagcgttcctttctgaagaactgctct
ggtctggaggaccctacttttggctactctactggacagccctgcatccttctaaagatg
aaccggattgtaggctttcgtcctgagcttggagatcctgtgaaggtttcctgcaaagtt
cagagaggtgatgaaaatgacatccgatccatcaattactacccagagtcggcttctttt
gacctccgctactacccttactacggcaaactcactcacgttaactacacctccccgctg
gtggcaatgcactttacagatgtggtgaagaaccaagtggtgcctgtgcagtgccagctg
aagggcaaaggcattataaacgatgtcatcaacgatcattttgtgggcagggtaatcttt
accctgaacatagaaacctaa

KEGG   Loxodonta africana (African savanna elephant): 100661428
Entry
100661428         CDS       T04351                                 

Gene name
ATP1A1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04911  Insulin secretion
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04964  Proximal tubule bicarbonate reclamation
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav04974  Protein digestion and absorption
lav04976  Bile secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100661428 (ATP1A1)
   04022 cGMP-PKG signaling pathway
    100661428 (ATP1A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100661428 (ATP1A1)
   04918 Thyroid hormone synthesis
    100661428 (ATP1A1)
   04919 Thyroid hormone signaling pathway
    100661428 (ATP1A1)
   04925 Aldosterone synthesis and secretion
    100661428 (ATP1A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100661428 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    100661428 (ATP1A1)
  09154 Digestive system
   04970 Salivary secretion
    100661428 (ATP1A1)
   04971 Gastric acid secretion
    100661428 (ATP1A1)
   04972 Pancreatic secretion
    100661428 (ATP1A1)
   04976 Bile secretion
    100661428 (ATP1A1)
   04973 Carbohydrate digestion and absorption
    100661428 (ATP1A1)
   04974 Protein digestion and absorption
    100661428 (ATP1A1)
   04978 Mineral absorption
    100661428 (ATP1A1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100661428 (ATP1A1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100661428 (ATP1A1)
   04964 Proximal tubule bicarbonate reclamation
    100661428 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100661428 (ATP1A1)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100661428 (ATP1A1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100661428 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   100661428 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   100661428 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   100661428 (ATP1A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 100661428
NCBI-ProteinID: XP_010587900
LinkDB
Position
Unknown
AA seq 992 aa
MDELKKEVTMDDHKLSLDELHRKYGTDLSRGLTTARAAEILARDGPNALTPPPTTPEWVK
FCRQLFGGFSMLLWIGAILCFLAYGILAATEEELENDNLYLGVVLSAVVIITGCFSYYQE
AKSSKIMESFKNMVPQQALVVRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGC
KVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVIYTGDRTVMGRIA
TLASGLEGGQTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVAN
VPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM
WFDNQIHEADTTENQSGVSFDKSSITWLALSRIAGLCNRAVFQANQENIPILKRAVAGDA
SESALLKCIELCCGSVKEMREQYTKIVEIPFNSTNKYQLSIHKNPNTSEPRHLLVMKGAP
ERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLSLPDEQFPEGFQF
DTDDVNFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGV
GIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTPEQLDDILKYHTEIVFA
RTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILL
DDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCID
LGTDMVPAISLAYEQAESDIMKRQPRNPQTDKLVNERLISMAYGQIGMIQALGGFFTYFV
IMAENGFLPIDLLGLRVDWDDRWINDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQW
ADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRMYPLKPTWWFCA
FPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggatgagctgaagaaagaagttactatggatgaccataaacttagccttgatgaactt
catcgcaaatatggaacagacttgagccgaggcttaacaactgcccgagctgcagagatc
ctggcccgagacggtcccaatgccctcacaccccctcccactactcctgaatgggtcaag
ttctgtcggcagctgtttggaggattctctatgttactgtggattggagcgattctttgt
ttcctggcttatggcatcctagctgccacggaagaggaactcgaaaacgataatctttat
cttggtgtggtgctatcagctgttgtcatcataactggttgtttctcttactatcaagaa
gctaaaagctccaagatcatggagtccttcaaaaacatggttcctcagcaagcccttgtg
gttcgaaacggtgagaaaatgagcatcaatgccgaagacgttgtcgtcggggatctggtg
gaagtgaaaggaggagaccgaatccctgctgatttgagaatcatatctgcaaatggctgc
aaagtggataactcctcactcactggagagtcagaaccccagaccaggtctccggatttc
acaaatgaaaaccccctggagacaaggaacattgcctttttttcaaccaactgcgtggaa
ggcactgcacgtggcattgttatatacactggggaccgcaccgtgatggggcgtattgcc
acacttgcttctggactagaaggaggtcagactccgattgctgcagaaattgagcatttt
atccacatcatcacgggggtggctgtgttcctgggtgtgtcgttcttcatcctgtctctc
atcttggaatacacctggcttgaggctgtcattttcctcatcggtatcatcgtagccaat
gtgccagaaggtttgctggccactgtcacggtgtgtctgacgcttactgccaaacgcatg
gcaaggaaaaactgcctagtgaagaacttagaagcagtggagaccttggggtctacatcc
accatttgttctgataaaactggaactctcactcagaaccggatgacagttgcccacatg
tggtttgacaatcaaatccatgaagctgataccacagagaatcagagtggtgtctcattt
gacaagtcttcaatcacctggcttgccctgtccagaattgcaggcctttgtaaccgggca
gtgtttcaggctaaccaggaaaacatacctatccttaagcgggcagttgcaggagatgcc
tctgagtcagctctcttaaaatgcattgagttgtgctgtggctctgtgaaggagatgagg
gagcagtacaccaagattgtggagatacccttcaactccaccaacaagtaccagctgtct
atccataagaacccgaacacgtctgaaccccggcacctgttggtgatgaagggagctcca
gagaggatcctggaccgctgcagctctatccttctccacgggaaggagcagccactggat
gaggagctaaaagatgcctttcagaatgcctacctggagctggggggccttggagaacga
gtgctaggtttttgccacctttctctgccagatgaacagtttcctgaagggtttcagttt
gacaccgatgatgtgaatttccctgtcgataacctctgctttgtcgggctcatctccatg
attgaccctccacgtgctgctgttcccgatgccgtgggcaaatgccgaagtgctggaatt
aaggtcatcatggtcacaggagaccacccaatcacagctaaagccattgccaaaggtgtg
ggcatcatctcagagggcaacgagacagtggaagacatcgctgctcgtctcaacatcccc
gtgagccaggtgaaccccagagatgccaaggcctgtgtggtccatggaagtgacctgaaa
gacatgacccctgagcagctggatgacatcctgaagtaccacactgagattgtgtttgcc
agaacctcccctcagcagaagctcatcattgtggaaggctgccagagacagggtgcaatt
gtggccgtaactggtgatggcgtaaatgactctccagctttgaagaaagcagacatcggg
gttgctatggggattgctggctcagatgtgtctaagcaagctgctgacatgatccttttg
gatgacaactttgcctcaattgtgactggagtagaggaaggtcgtctaatctttgataac
ttgaagaaatccattgcttacaccctaaccagtaacattccagagatcacccccttcctg
atatttattattgcaaacattccactaccactggggaccgtcaccatcctctgcattgac
ttgggcactgacatggttcccgccatttctctggcttatgagcaagctgagagtgacatc
atgaagaggcagcctagaaacccccagacagacaaactagttaatgagcggctgatcagt
atggcatacggacagataggtatgatccaggcactgggaggcttcttcacttactttgtg
attatggctgagaatggcttcctccctattgacctgctgggcctccgagtggactgggat
gaccgttggatcaatgatgtagaagacagctacgggcagcagtggacctatgagcagagg
aaaatcgtggagttcacctgccacactgccttctttgtcagcattgtggtggtgcagtgg
gctgacttggtcatctgcaagaccaggaggaattcagtattccagcaggggatgaagaac
aagatcttaatttttggcctctttgaagagacagcccttgctgctttcctttcctactgc
cctggcatgggtgtggccctgaggatgtatcccctcaaacctacctggtggttctgtgcc
ttcccctactcccttctcatctttgtatatgacgaagtccgaaaactcatcatcagacga
cgccccggcggctgggtggagaaggaaacctactactag

KEGG   Loxodonta africana (African savanna elephant): 100667801
Entry
100667801         CDS       T04351                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-4
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04911  Insulin secretion
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04964  Proximal tubule bicarbonate reclamation
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav04974  Protein digestion and absorption
lav04976  Bile secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100667801
   04022 cGMP-PKG signaling pathway
    100667801
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100667801
   04918 Thyroid hormone synthesis
    100667801
   04919 Thyroid hormone signaling pathway
    100667801
   04925 Aldosterone synthesis and secretion
    100667801
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100667801
   04261 Adrenergic signaling in cardiomyocytes
    100667801
  09154 Digestive system
   04970 Salivary secretion
    100667801
   04971 Gastric acid secretion
    100667801
   04972 Pancreatic secretion
    100667801
   04976 Bile secretion
    100667801
   04973 Carbohydrate digestion and absorption
    100667801
   04974 Protein digestion and absorption
    100667801
   04978 Mineral absorption
    100667801
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100667801
   04961 Endocrine and other factor-regulated calcium reabsorption
    100667801
   04964 Proximal tubule bicarbonate reclamation
    100667801
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100667801
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100667801
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100667801
  Exosomal proteins of other body fluids (saliva and urine)
   100667801
  Exosomal proteins of colorectal cancer cells
   100667801
  Exosomal proteins of bladder cancer cells
   100667801
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 100667801
NCBI-ProteinID: XP_010593170
LinkDB
Position
Unknown
AA seq 997 aa
MEELKKEVVMDDHKLTLKQLSAKYSVDLTKGLTSEQAQEILGREGPNTLTPPPTTPEWVK
FCKQLFGGFSILLWIGSFLCFVAYGIQFYFDDESTNDNLYLGIVLSIVVIITGCFSYYQE
AKSSKIMESFKNMVPQQALVIRGGEKMQINVQDVVLGDLVEVKGGDRIPADIRLISSQGC
KVDNSSLTGESEPQSRSPEFTHENPLETRNICFFSTNCVEGTGRGIVIATGDSTVMGRIA
SLTSGLAVGKTPIAAEIEHFIHLITVVAIFLGISFFMLSLLLGYGWLQAVIFLIGIIVAN
VPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM
WFDKTIYEADTTEDQTENTFAKNSPTWFILARIAGLCNRADFKANQETLPIAKRETTGDA
SESALLKFIEQTYSPVKEMRNKSPKVAEIPFNSTNKYQMSIHLQEDSSHTYVLLMKGAPE
RILDLCSTFLLNGQEYPMNSDMKNAFQNAYLELGGLGERVLGFCFLNLPKSYSKGFPFDT
DEINFPMEKLCFVGLISMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGI
ISEGTETIEDMAARLQVPVSQINPRDVKAIVVHGSELKNLSSEQLDEILKNHSEIVFART
SPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGITGSDVSKQAADMILLDD
NFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIILSIPLPLGTITILCIDLG
TDMVPAISLAYETAESDIMKRVPRDPKSDKLVNYRLIGMAYGQIGMIQALAGFFTYFVIL
AENGFKPLDLLGIRLKWEDQYLNDLEDSYGQQWTFEQRKVVEFTCHTAFFISIVVVQWAD
LIICKTRRNSVFQQGMKNKVLLFGIVEETFLAAFMSYTPGMDMALRMYPLKVTWWVCAMP
YSLLIFTYDELRKYIIRRRPGGEAPLSPALTIGPPAP
NT seq 2994 nt   +upstreamnt  +downstreamnt
atggaggagctgaagaaagaagtggtcatggatgatcacaaattaaccttgaaacagctg
agtgcgaagtattcagtggatctgacaaagggccttacctctgaacaggcacaggaaatc
ctaggacgagagggacccaatacacttactccaccccccaccactccagaatgggtcaaa
ttctgtaaacaactgttcgggggcttctccatcctactgtggattggttcctttctctgc
tttgtggcctatggcatccagttctatttcgatgatgagtctaccaacgataatctgtac
ctgggcatagtactaagcatcgtagtcatcatcactggctgcttctcctactaccaggag
gccaagagctccaagatcatggagtctttcaagaacatggtgccacagcaagccctggta
attcgaggaggagagaagatgcagatcaatgtacaagacgtggtgttgggagacctggta
gaagtgaagggtggagaccgaatcccggctgacatccgacttatctcttcacaaggatgt
aaggtggacaactcatccttgacaggagagtctgagccccaaagtcgctcccccgagttc
acccatgagaaccctctggagacccgaaacatctgtttcttctccaccaactgtgtggaa
ggaacaggccgtggcattgtgatcgctacaggagactccacagtgatgggccgcattgcc
tcactgacatcaggcctggcagttggcaagacccccattgctgctgagatcgagcacttc
atccatctgatcaccgtggtggccatcttcctggggatctctttctttatgctttcgctt
ctcttgggctatggctggctgcaggctgttatttttcttattggaatcattgtggccaat
gtgcctgaggggctgctggccaccgtcactgtgtgtctgaccctgacagcaaagcgcatg
gcacgcaagaactgcctggtgaagaaccttgaggcagtggagacactgggctccacctcc
accatttgctccgacaagacaggcacgctcactcagaaccgcatgaccgttgcccacatg
tggtttgataagaccatatacgaggccgacaccaccgaagaccagactgagaatacattt
gccaagaactctcctacctggttcatcctagcccgaatcgctggtctctgcaacagggct
gactttaaggctaatcaggagacacttcccatagctaagcgtgaaacaacaggcgatgct
tctgagtcggccctgctcaagttcatcgagcagacttacagccctgtgaaggagatgaga
aacaagagccccaaggtggcagagattccctttaattctaccaacaagtaccagatgtct
atccaccttcaggaggatagctcccatacctacgtgctgctgatgaagggggctcccgag
aggatcttggacttgtgctctactttcctgctgaatgggcaggagtacccaatgaacagt
gacatgaagaatgccttccagaatgcctacttggagctgggaggtctgggggaacgtgtg
ctagggttctgtttcttgaatctgcctaagagttactccaagggattcccttttgatacc
gatgaaatcaattttcccatggagaagctttgttttgtggggctcatatccatgattgac
cctccacgtgccgctgtgcctgatgctgtgagcaagtgtcgtagtgcagggattaaggtg
atcatggtaacaggggatcatcccattacagccaaggccatcgccaagggtgtgggcatc
atctcagaaggtactgagacaatagaggacatggctgcccggctccaggtccctgtcagc
cagatcaatcccagggatgtcaaagccattgtggtgcacggctcagaactaaagaatttg
tcatcagaacagcttgacgagatccttaagaaccactcagagattgtgttcgccaggacc
tcccctcagcagaagctcatcatcgtggagggatgtcagaggcagggcgccattgtagca
gtgacgggtgatggagtaaatgactcccctgcactgaagaaggctgacattggcattgcc
atgggcatcactggctctgatgtctctaagcaggcggccgacatgatcctgctggacgac
aactttgcctccattgtcacgggcgtggaggagggccgcctcatctttgacaacctgaag
aaatccattgcgtacaccctgaccagcaacatccctgagatcacccccttcctgctcttc
atcatcctcagtatacctctgcctctagggaccatcaccattctctgcatcgacctaggc
actgacatggtccctgctatctccttggcttatgagacagctgaaagcgacatcatgaag
agggttccacgggatccaaagtctgataaactagtgaactaccgtctcattggcatggcc
tacggacagattgggatgatccaggctctggctggattcttcacctactttgtgatcctg
gccgagaacggttttaagcctttggatctgctaggcatccgcctcaagtgggaagatcaa
tacttgaatgacctggaagacagctatggacagcagtggaccttcgagcagcggaaggtg
gtggagttcacgtgccatacagccttctttatcagcatcgtggttgtacagtgggctgac
ctcatcatctgcaagacccgccgcaactcggtcttccagcagggcatgaaaaacaaggtc
ctactgtttgggatcgtggaggagacattcctagctgcttttatgtcctacactccaggc
atggacatggccctgcgaatgtacccactcaaggtaacctggtgggtctgtgccatgccc
tacagccttcttatcttcacctatgatgaactcagaaaatacatcatccgacgaaggcct
ggcggtgaggcgcccctgagccctgctctgactattggaccaccagccccctaa

KEGG   Loxodonta africana (African savanna elephant): 100668326
Entry
100668326         CDS       T04351                                 

Gene name
ATP1A3
Definition
(RefSeq) LOW QUALITY PROTEIN: sodium/potassium-transporting ATPase subunit alpha-3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04911  Insulin secretion
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04964  Proximal tubule bicarbonate reclamation
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav04974  Protein digestion and absorption
lav04976  Bile secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100668326 (ATP1A3)
   04022 cGMP-PKG signaling pathway
    100668326 (ATP1A3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100668326 (ATP1A3)
   04918 Thyroid hormone synthesis
    100668326 (ATP1A3)
   04919 Thyroid hormone signaling pathway
    100668326 (ATP1A3)
   04925 Aldosterone synthesis and secretion
    100668326 (ATP1A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100668326 (ATP1A3)
   04261 Adrenergic signaling in cardiomyocytes
    100668326 (ATP1A3)
  09154 Digestive system
   04970 Salivary secretion
    100668326 (ATP1A3)
   04971 Gastric acid secretion
    100668326 (ATP1A3)
   04972 Pancreatic secretion
    100668326 (ATP1A3)
   04976 Bile secretion
    100668326 (ATP1A3)
   04973 Carbohydrate digestion and absorption
    100668326 (ATP1A3)
   04974 Protein digestion and absorption
    100668326 (ATP1A3)
   04978 Mineral absorption
    100668326 (ATP1A3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100668326 (ATP1A3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100668326 (ATP1A3)
   04964 Proximal tubule bicarbonate reclamation
    100668326 (ATP1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100668326 (ATP1A3)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100668326 (ATP1A3)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100668326 (ATP1A3)
  Exosomal proteins of other body fluids (saliva and urine)
   100668326 (ATP1A3)
  Exosomal proteins of colorectal cancer cells
   100668326 (ATP1A3)
  Exosomal proteins of bladder cancer cells
   100668326 (ATP1A3)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 100668326
NCBI-ProteinID: XP_023399780
LinkDB
Position
Unknown
AA seq 1212 aa
METHQETQGETEIHRDSRLPRDMLGADTERRATARGMEGRCPPLTPSRPQSGRSDSYRVA
TSQDKKDDKGSPKKGKGTKDRRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKA
QEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSRD
NLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVG
DLVEIKGGDRVPADLRIISAHGCKVRLWPGVPALASPRPRSPAPTSVHAMGPHPHLMPHP
LWLTGTARDVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFF
ILSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETL
GSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGL
CNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNK
YQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGG
LGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCR
SAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHG
TDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKK
ADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEI
TPFLLFIMANIPLPLGTITILCIDLGTDMVSHSHAWALGGQRLPLPGSPGLSCQVPAISL
AYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGN
LVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRN
SVFQQGMKXALAEQDLIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLI
FVYDEIRKLILRRNPGGEGHHRVKGEDWGDRARTAGVGRREEALWNFRNARRTPAVAVFG
LHFPRCFASDPAIMASIAPDTIRTTTPTMLSDRTPAPRGSGASPRPLRWVRPGSGGADSV
YRARGSLQRFYP
NT seq 3639 nt   +upstreamnt  +downstreamnt
atggaaactcaccaagagacacagggagagacagagatccacagagatagccgcctgccc
agagacatgctaggagcagacacagagaggagagctacagccaggggcatggagggccgg
tgtccccctttaaccccttctcgcccgcagtctggtcgctctgacagctatcgtgtcgcc
acctcgcaggacaagaaagatgacaagggctcgcccaagaagggcaagggcaccaaagac
cgcagggatctggatgacctcaagaaggaggtggcaatgacagagcacaagatgtccgtg
gaagaggtctgccgaaagtacaacacggactgtgtgcagggtttgacccacagcaaagcc
caggagatcctggcccgagatgggcccaacgcgcttacaccaccacctaccaccccagag
tgggtcaagttctgccgccagctctttgggggcttctccatcctgctgtggattggagcc
atcctctgcttcctggcttatggtatccaggctggcactgaggacgacccatctcgtgat
aatctgtacctgggcatcgtgctcgcggccgtggtaatcatcaccggctgcttctcctac
taccaggaggccaagagctccaagatcatggaatccttcaagaacatggttccccagcaa
gccttggtgatccgggaaggtgagaagatgcaggtgaatgctgaggaggtggtggttggc
gacctggtggagatcaagggtggagaccgagttcctgccgacctgcgcatcatctcagcc
cacggctgcaaagtgcgtctgtggcctggggtcccggctctggcctcccccagacccagg
agtccagcccctacctcagtccacgcaatgggcccgcacccgcacctcatgcctcatcct
ctctggctcacaggcaccgctcgggatgtggtggtggcaaccggggaccgcactgtcatg
ggacgcatagccaccctggcttcggggctggaggtgggcaagacacccattgccatcgaa
atcgagcacttcatccagctcatcactggcgtggccgtcttcctgggcgtctccttcttc
atcctctccctcattctggggtacagctggctcgaggccgtcatcttcctcatcggcatc
atcgtggccaatgtaccagagggtctgctggccactgtcactgtgtgtctgacgctgacc
gccaagcgcatggcccggaagaactgccttgtgaaaaacctggaggctgttgagaccctg
ggctccacgtccaccatctgctcagacaagacagggaccctcacccagaaccgcatgacg
gttgcccacatgtggtttgacaaccaaatccacgaggccgacaccaccgaggaccagtca
ggaacctccttcgacaagagctcacacacatgggtggccctgtcccacatcgccggcctt
tgcaatcgcgccgtcttcaagggtggccaggataacatccctgtgctgaagagggatgtg
gccggggatgcctctgagtctgccctgctgaagtgcattgagctgtcctccggctctgtg
aagctgatgcgcgaacgcaacaagaaggtggctgagattcctttcaactccaccaacaaa
taccagctgtccatccacgagaccgaggaccccaacgacaatcggtacctgctggtgatg
aagggtgcccctgagcgcatcctggaccgctgctccaccatcctgctgcagggcaaggag
cagccgctagatgaggagatgaaggaggccttccagaatgcctacctcgaactcggcggc
ctgggcgagcgcgtgcttggcttctgccattactacctgcctgaggaacagttccccaag
ggctttgccttcgactgcgacgacgtgaacttcaccacggacaacctctgctttgtgggc
ctcatgtccatgatcgacccaccccgggcagctgtccccgatgcagttggcaagtgccga
agtgcaggcatcaaggttatcatggtcacgggggatcaccccatcaccgccaaggccatt
gccaagggtgtgggcatcatctcagagggcaacgagacggtggaggacatcgctgccagg
ctcaacatccccgtcagccaagtcaacccccgggacgccaaggcctgtgtgatccacggc
accgacctcaaggacttcacctccgagcaaattgatgagattctgcagaaccacactgag
atcgtgtttgcccgcacgtccccccagcagaaactcatcattgtggagggctgtcagaga
cagggagcaattgtggccgtgactggagatggtgtgaacgactcccctgctctgaagaag
gctgacatcggggtggcaatgggtattgctggctcagacgtctctaagcaggcagccgac
atgattctgctggatgacaactttgcctccattgtcacgggtgtggaggagggccgcctg
atcttcgacaacctgaagaagtccatcgcctacaccctgaccagcaacatccccgagatc
acgcccttcctgctgttcatcatggccaacatcccactgcccctgggcaccatcaccatc
ctctgcatcgacctgggcactgacatggtgagccacagccatgcctgggccctgggaggg
cagcgccttcccctccccggctcacctggtctctcctgccaggtccccgccatctcactg
gcatacgaggctgctgagagtgacatcatgaagagacagcccaggaacccacggaccgac
aagctggtcaatgagaggctcatcagcatggcttacgggcagattggaatgatccaggcg
cttggtggctttttctcctactttgtgatcctggcagaaaatggcttcttgcccggcaac
ctggtgggcatccgactgaactgggatgaccgcactgtcaatgacctggaggacagctac
gggcagcagtggacatacgagcagaggaaagtggtggagttcacatgccacacggccttc
tttgtgagcattgtggtcgttcagtgggccgacctcatcatctgcaagacccgaaggaac
tcagtcttccagcagggcatgaagtgagcgctggcagaacaagatctgatcttcggcttg
tttgaggagacagcccttgctgccttcctgtcatactgccctggcatggatgtggccctc
cgcatgtaccctctcaagcccagctggtggttctgtgccttcccctacagtttcctcatc
ttcgtctacgacgaaatccgcaaactcattctgcgcaggaaccccgggggtgaggggcat
cacagggtgaaaggggaagattggggggatagggccaggacagctggagtggggaggcgg
gaagaagctttgtggaacttccgcaacgctcgaaggacacccgccgtcgccgtatttgga
ctacatttcccaaggtgctttgcgagtgaccctgccatcatggcgtccatcgcaccagac
acgatcaggactacaactcccacgatgcttagcgacagaactcctgccccccgcggttcc
ggagcctcgccacgtccgctccgctgggtgaggccgggctcgggaggggcggacagcgtc
taccgggcccggggctcgttacagaggttctacccctaa

KEGG   Loxodonta africana (African savanna elephant): 100668753
Entry
100668753         CDS       T04351                                 

Gene name
ATP1B2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-2
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04911  Insulin secretion
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04964  Proximal tubule bicarbonate reclamation
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav04974  Protein digestion and absorption
lav04976  Bile secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100668753 (ATP1B2)
   04022 cGMP-PKG signaling pathway
    100668753 (ATP1B2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100668753 (ATP1B2)
   04918 Thyroid hormone synthesis
    100668753 (ATP1B2)
   04919 Thyroid hormone signaling pathway
    100668753 (ATP1B2)
   04925 Aldosterone synthesis and secretion
    100668753 (ATP1B2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100668753 (ATP1B2)
   04261 Adrenergic signaling in cardiomyocytes
    100668753 (ATP1B2)
  09154 Digestive system
   04970 Salivary secretion
    100668753 (ATP1B2)
   04971 Gastric acid secretion
    100668753 (ATP1B2)
   04972 Pancreatic secretion
    100668753 (ATP1B2)
   04976 Bile secretion
    100668753 (ATP1B2)
   04973 Carbohydrate digestion and absorption
    100668753 (ATP1B2)
   04974 Protein digestion and absorption
    100668753 (ATP1B2)
   04978 Mineral absorption
    100668753 (ATP1B2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100668753 (ATP1B2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100668753 (ATP1B2)
   04964 Proximal tubule bicarbonate reclamation
    100668753 (ATP1B2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100668753 (ATP1B2)
CD molecules [BR:lav04090]
 Proteins
  100668753 (ATP1B2)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 100668753
NCBI-ProteinID: XP_023412187
LinkDB
Position
Unknown
AA seq 274 aa
MGVGEVVVGDLKFTDLISSSLAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDR
LATPGLMIRPKTENLDVIVNISDTESWDQHVQKLNKFLEPYNDSIQAQKNDICRPGRYYE
QPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFIKMNRVINFYAGANQSM
NVTCAGKREEDAENLGSFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVE
VNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 825 nt   +upstreamnt  +downstreamnt
atgggtgtaggtgaggtcgtggtgggagacttgaaatttactgaccttatttcctcttcc
ctagcctttatccttctcttctacctcgtcttctatggcttcctcacagccatgttcacc
ctcacaatgtgggtgatgctacagactgtttctgaccatactcccaagtaccaggaccga
ctagccacaccgggcttgatgattcgccccaagactgagaaccttgatgtcattgtcaac
atcagtgacactgaaagctgggatcagcatgttcagaaactcaacaagttcttggagcct
tataatgactcaatccaagcccaaaagaatgacatctgccgccctggacgttattatgaa
cagcctgataatggagtcctcaactacccgaaacgtgcctgccaattcaaccggacccag
ctgggtgactgctctggcattggagaccccactcactatggttacagcactgggcagccc
tgtgtcttcatcaagatgaaccgggtcatcaacttctatgcaggagcaaaccagagcatg
aatgttacgtgtgcagggaagcgagaggaagatgctgagaacctcggcagctttgtgatg
ttccctgccaatggcaacatcgacctcatgtacttcccatactatggcaaaaagttccac
gtgaactacacgcagcccttggtggctgtgaagttcctgaatgtgacccccaatgtggag
gtgaacgtggaatgccgcatcaacgctgccaacatcgccacagacgatgagcgagacaag
ttcgctggccgcgtggccttcaaactccgcatcaacaaaacctga

KEGG   Loxodonta africana (African savanna elephant): 100674070
Entry
100674070         CDS       T04351                                 

Gene name
ATP1A2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04911  Insulin secretion
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04964  Proximal tubule bicarbonate reclamation
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav04974  Protein digestion and absorption
lav04976  Bile secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100674070 (ATP1A2)
   04022 cGMP-PKG signaling pathway
    100674070 (ATP1A2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100674070 (ATP1A2)
   04918 Thyroid hormone synthesis
    100674070 (ATP1A2)
   04919 Thyroid hormone signaling pathway
    100674070 (ATP1A2)
   04925 Aldosterone synthesis and secretion
    100674070 (ATP1A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100674070 (ATP1A2)
   04261 Adrenergic signaling in cardiomyocytes
    100674070 (ATP1A2)
  09154 Digestive system
   04970 Salivary secretion
    100674070 (ATP1A2)
   04971 Gastric acid secretion
    100674070 (ATP1A2)
   04972 Pancreatic secretion
    100674070 (ATP1A2)
   04976 Bile secretion
    100674070 (ATP1A2)
   04973 Carbohydrate digestion and absorption
    100674070 (ATP1A2)
   04974 Protein digestion and absorption
    100674070 (ATP1A2)
   04978 Mineral absorption
    100674070 (ATP1A2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100674070 (ATP1A2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100674070 (ATP1A2)
   04964 Proximal tubule bicarbonate reclamation
    100674070 (ATP1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100674070 (ATP1A2)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100674070 (ATP1A2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100674070 (ATP1A2)
  Exosomal proteins of other body fluids (saliva and urine)
   100674070 (ATP1A2)
  Exosomal proteins of colorectal cancer cells
   100674070 (ATP1A2)
  Exosomal proteins of bladder cancer cells
   100674070 (ATP1A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 100674070
NCBI-ProteinID: XP_003415228
LinkDB
Position
Unknown
AA seq 1020 aa
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAFGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKIQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVKKMRERNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCHLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVTQVNPREAKAC
VVHGSDLKDMTAEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLMFIIVNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSRNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILVFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFLYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgggccgtggggccggccgtgagtactcacctgctgccaccaccgcagagaatgggggc
ggcaagaagaagcagaaagagaaggagctggatgagctgaagaaggaggtggccatggat
gaccataagctgtccctggatgagctgggccgcaagtaccaagtggacctgtccaagggc
ctcaccaaccagcgggcccaggacatcctggctcgagatggacccaatgccctcactcca
ccccctaccacccccgagtgggtcaagttctgtcgccagctttttgggggcttctccatc
ctgctgtggatcggggccatcctctgcttcctggccttcggcatccaggctgccatggag
gatgagccatccaatgacaatctctatctgggtgtagtgctggcagctgtggtcatcgtc
accggctgcttctcctactaccaggaggccaagagctccaagatcatggattccttcaag
aacatggtgcctcagcaagccctcgtggtgcgggagggagagaagatacagatcaatgca
gaggaggtagtggtgggagacctggtagaagtgaagggtggagaccgcgtccctgctgac
ctccgtatcatctcttctcacggatgtaaggtggataactcatccctcacaggcgagtca
gagccccagacccgctccccggagttcacgcatgagaaccctctggagacccgcaatatc
tgtttcttctctactaactgtgttgaaggcactgccaggggcatcgtgattgccacaggt
gaccggacagtgatgggtcgcatagccactctggcctcaggcctagaggttgggcggacg
cctatagctatggagatcgaacacttcatccagctgatcacaggggtggccgtgttcctg
ggagtctccttcttcgtactctccctcatcctgggctacagttggctggaagcagtcatc
ttccttatcggcatcattgtggccaatgtgcctgaagggctgctggccactgtcactgtg
tgtctgaccctgacagccaagcgcatggcgcgaaagaactgcctggtgaagaaccttgag
gcggtggagacgctgggctccacctccaccatctgctctgacaagacaggcacccttacc
cagaatcgtatgactgtcgcccacatgtggtttgataaccagatccatgaggctgacacc
acagaagaccagtctggggccacttttgacaaacgatcccccacatggacagctctgtct
cggattgccggtctttgcaaccgtgctgtcttcaaggccggacaggagaacatctctgta
tctaagcgggacacagctggtgatgcctctgagtcagctctgctcaagtgcattgagctg
tcctgtggctcagtgaagaagatgagggagaggaaccccaaggtggcagagattcctttc
aactccaccaacaaataccagctgtccatccatgaaagagaagacagcccccagagccat
gtgctcgtgatgaagggggccccagagcgcatcctggaccggtgctccactatcctggtg
cagggcaaggagatcccactggacaaggaaatgcaagacgccttccaaaatgcctacatg
gagctgggaggattgggggagcgtgtcctggggttctgtcacctgaatctgccatctgga
aagtttcctcggggcttcaaattcgacacagatgagctgaactttcccacggagaagctc
tgctttgtggggctcatgtctatgattgaccctccccgggctgcagtgccggatgctgtg
ggcaaatgccggagcgcaggcatcaaggtgatcatggtgactggggatcatcctatcaca
gccaaggccattgccaaaggcgtgggcattatatccgagggcaacgagactgtggaagac
attgcagcccggctcaacattcctgtgactcaagtcaaccccagagaagccaaggcgtgt
gtggtgcacggctctgacctgaaggacatgactgcagagcagctcgacgagatcctcaag
aaccacacggagattgtgttcgctcggacctcccctcagcagaagctcatcatcgtggag
ggatgtcagaggcagggtgccatcgtggcagtgacgggtgatggagtgaatgattcccct
gcgctgaagaaggctgacattggcattgccatgggcatctctggctctgatgtctctaag
caggcggccgacatgatcctgctggacgacaactttgcctccattgtcacaggcgtggag
gagggccgcctgatctttgacaacctgaagaaatccattgcctacaccctgaccagcaac
attcctgagatcacccccttcctgatgttcatcattgtcaacatccccctccctctgggc
accgtgaccatcctctgcattgacctaggcacagacatggtccccgccatctccttggcc
tatgaggcagccgagagtgacatcatgaagcggcaacccagaaacccccagacagacaaa
ctggtgaacgagaggctcatcagcatggcctatggacagattggaatgatccaggccctg
ggtggcttcttcacctactttgtgatcctggccgagaacggtttcctaccatcacggctg
ctgggaatccgcctagactgggatgaccggtccaggaatgacctggaggacagctatgga
caggagtggacctatgagcagcggaaggtggtggagttcacgtgccacacggccttcttt
gccagcatcgtggtcgtacagtgggctgacctcatcatctgcaagacccgccgcaactca
gtcttccagcagggcatgaagaacaagattctggtatttgggctcctggaggagacagcg
ctggctgcttttctgtcttactgcccaggcatgggtgtagccctccgcatgtacccgctc
aaggtcacttggtggttctgtgccttcccttacagtctcctcatcttcctctatgacgag
gtccggaagctcatcttacggcgatatcctggtggctgggtggagaaggagacatactac
tga

KEGG   Loxodonta africana (African savanna elephant): 100676526
Entry
100676526         CDS       T04351                                 

Gene name
ATP1B1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04911  Insulin secretion
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04964  Proximal tubule bicarbonate reclamation
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav04974  Protein digestion and absorption
lav04976  Bile secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100676526 (ATP1B1)
   04022 cGMP-PKG signaling pathway
    100676526 (ATP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100676526 (ATP1B1)
   04918 Thyroid hormone synthesis
    100676526 (ATP1B1)
   04919 Thyroid hormone signaling pathway
    100676526 (ATP1B1)
   04925 Aldosterone synthesis and secretion
    100676526 (ATP1B1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100676526 (ATP1B1)
   04261 Adrenergic signaling in cardiomyocytes
    100676526 (ATP1B1)
  09154 Digestive system
   04970 Salivary secretion
    100676526 (ATP1B1)
   04971 Gastric acid secretion
    100676526 (ATP1B1)
   04972 Pancreatic secretion
    100676526 (ATP1B1)
   04976 Bile secretion
    100676526 (ATP1B1)
   04973 Carbohydrate digestion and absorption
    100676526 (ATP1B1)
   04974 Protein digestion and absorption
    100676526 (ATP1B1)
   04978 Mineral absorption
    100676526 (ATP1B1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100676526 (ATP1B1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100676526 (ATP1B1)
   04964 Proximal tubule bicarbonate reclamation
    100676526 (ATP1B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100676526 (ATP1B1)
CD molecules [BR:lav04090]
 Proteins
  100676526 (ATP1B1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 100676526
NCBI-ProteinID: XP_003414933
UniProt: G3TAL8
LinkDB
Position
Unknown
AA seq 303 aa
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISDFRPTYQDRVAPPGLTQLPQIQKTEISFRPLDPKSYEAYVLNIVRFLEKYKDSAQKDE
MIFEDCGNVPSDIKERGEYNNERGERKVCRFRLEWLGNCSGINDESFGYKEGKPCIIIKL
NRVLGFKPKPPKNDSMEAYPMMKYSPYVLPVQCTGKRDEDKEKIGNVEYFGLGGYPGFPL
QYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
VKS
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcccggggaaaagccaaggaggaggggagctggaagaaattcatctggaactcggag
aagaaggagtttttgggcaggaccggcggcagttggtttaagatccttctcttctacgta
atattctatggctgcttggctggcatcttcattggaaccatccaggtgatgctgctcacc
atcagtgacttcaggcccacctatcaggaccgagtggccccaccagggttaacacagctt
cctcagatccaaaagactgaaatttcctttcgacccctggaccccaagagctacgaggcg
tacgtgctgaacatagtcaggttcctggagaagtacaaagattcggcccagaaggacgaa
atgatatttgaagactgtggcaacgtgcccagcgacatcaaagaacgaggcgaatataac
aacgagcgtggggagcgcaaagtctgcaggttcaggctggagtggctgggaaattgctca
ggaataaatgatgagtcttttggctacaaagagggcaaaccgtgtatcattatcaagctc
aaccgagttctgggcttcaaacctaagcctcccaagaatgactcaatggaagcttaccca
atgatgaagtatagtccttatgtcctgcctgttcagtgtactggcaagcgagacgaagat
aaggaaaaaattggaaatgtggagtactttggactaggcggctaccctggttttcctctg
cagtattatccctactatggcaaactcctgcagcccaagtacctgcagcccctgctggcc
gtgcagttcaccaacctcactgtggacactgaaattcgcatagagtgtaaggcctatggg
gagaacatcgggtacagtgagaaagaccgttttcagggacgctttgacgtgaaaattgaa
gttaagagctga

KEGG   Loxodonta africana (African savanna elephant): 111752838
Entry
111752838         CDS       T04351                                 

Gene name
FXYD2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit gamma
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04911  Insulin secretion
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04964  Proximal tubule bicarbonate reclamation
lav04970  Salivary secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav04974  Protein digestion and absorption
lav04976  Bile secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    111752838 (FXYD2)
   04022 cGMP-PKG signaling pathway
    111752838 (FXYD2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111752838 (FXYD2)
   04918 Thyroid hormone synthesis
    111752838 (FXYD2)
   04919 Thyroid hormone signaling pathway
    111752838 (FXYD2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111752838 (FXYD2)
   04261 Adrenergic signaling in cardiomyocytes
    111752838 (FXYD2)
  09154 Digestive system
   04970 Salivary secretion
    111752838 (FXYD2)
   04972 Pancreatic secretion
    111752838 (FXYD2)
   04976 Bile secretion
    111752838 (FXYD2)
   04973 Carbohydrate digestion and absorption
    111752838 (FXYD2)
   04974 Protein digestion and absorption
    111752838 (FXYD2)
   04978 Mineral absorption
    111752838 (FXYD2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111752838 (FXYD2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    111752838 (FXYD2)
   04964 Proximal tubule bicarbonate reclamation
    111752838 (FXYD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    111752838 (FXYD2)
   04147 Exosome [BR:lav04147]
    111752838 (FXYD2)
Transporters [BR:lav02000]
 Other transporters
  Pores ion channels [TC:1]
   111752838 (FXYD2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111752838 (FXYD2)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 Gram_pos_anchor
Other DBs
NCBI-GeneID: 111752838
NCBI-ProteinID: XP_023413950
LinkDB
Position
Unknown
AA seq 64 aa
MDRWYSGGGSKGDADPFYYDYESVRNGGLIFAALAFIVGLIILLSKRLRCGGQKKHRQVN
EDEL
NT seq 195 nt   +upstreamnt  +downstreamnt
atggacaggtggtactcaggtggcggctccaagggggatgcggacccattctattacgac
tatgagtctgtccgcaacggtggcctgatcttcgctgccctagccttcatcgtggggctc
atcatcctcctcagcaaaaggctccgctgtgggggccaaaagaagcatcggcaagtcaat
gaagacgagctgtaa

DBGET integrated database retrieval system