KEGG   Loxodonta africana (African savanna elephant): 100655677
Entry
100655677         CDS       T04351                                 

Gene name
KIF22
Definition
(RefSeq) kinesin-like protein KIF22 isoform X4
  KO
K10403  kinesin family member 22
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100655677 (KIF22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100655677 (KIF22)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100655677 (KIF22)
SSDB
Motif
Pfam: Kinesin Microtub_bd HHH_3 HHH_6
Other DBs
NCBI-GeneID: 100655677
NCBI-ProteinID: XP_010596813
LinkDB
Position
Unknown
AA seq 664 aa
MDAGLRAQRRRREMAAATSGASRCLLSKVRAGRRPPPARVRVAVRLRPFVDGIAGANDTP
CVRGLDSCSLEISNWRNHQETLKYQFDAFYGERSSQQDIYAGSVQPILRHLLEGQNASVL
AYGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLTREEGAEGRPWALSVTMSYLEIYQEKV
LDLLDPASGDLVIREDCRGNILIPGLTQKPITGFADFERHFLPASRNRTVGATRLNQRSS
RSHAVLLVKVDQRERLAPFRQREGKLYLIDLAGSEDNRRTGNKGLRLKESGAINTSLFVL
GKVVDALNQGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFYLDTVTALNFAAR
SKEVINRPFTNESLQPHVLAPVRLSQKEPLGPTEAKRARGPEEEEIGSPESLAASASDTQ
KLSPLQKLSNIDPAMLERLLSLDRLLGSQGSQGTPLLSTPRRERMVLMKTVEEKDLEIER
LKVKQKELEAKVLAQEAADLKEKENCSPTMLRPLAHRTAPVAKPLKKAVVMPLQLLQEQA
ASPNTEIHILKKKGRKRKLESLDASEPEEKAEDCWEPQISPELLAHGRQKILDLLNKGSA
RDLRSLQRIGQKKAQLIVGWRELHGPFSQVEDLERVEGISGKQMESFLKANILGLAAGQR
CGPS
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggacgctgggctccgggcgcagcggagacgacgcgagatggcggcagcgacttcagga
gccagtcgctgtctgctaagcaaggtgagggctggccgacgcccgcctccagctcgagtc
agggtggctgtgcgactgcggccatttgtggacgggatagctggagcaaatgataccccc
tgtgtccgaggcctggacagctgctctctggagatttccaactggaggaaccaccaggag
actctcaaataccagtttgatgccttctatggggagaggagctcccagcaggacatctat
gctggttcagtgcagcccatcctaagacacttgctggaaggacagaatgccagtgtgctt
gcgtatgggcccacaggggcagggaaaacgcacacaatgctgggcagcccagagcagcct
ggggtgatccctcgggctctcatggacctcctgcagctcacaagggaggagggtgctgag
ggccgcccatgggccctctccgttactatgtcctacttagagatctaccaggaaaaggta
ctagacctcttagaccctgcatcaggagatctggtgatccgcgaagactgtcggggaaac
atcctgattccaggcctcacacagaagcccatcactggctttgctgattttgagcggcac
tttctgccagccagtcgaaatcggaccgtaggagccacccggctcaaccagcgttcctct
cgcagtcatgctgtgctcctggtcaaggtagatcagcgggaacggctggccccatttcgc
cagcgggagggaaaactctacctgattgacctggctggctcagaggacaaccggcgcaca
ggcaacaagggcctgcggctgaaggagagtggagccatcaacacctccctctttgtactg
ggcaaggtggtagatgcgctgaaccagggcctccctcgcgtaccttaccgggacagcaag
cttactcgcctgttgcaggactccctgggtggctcagcccacagcattctcattgccaac
attgcccctgaaagacgcttctacctagacacagtcactgcactcaactttgcagcaagg
tccaaagaggtgatcaaccggccctttaccaacgagagcctgcagcctcacgttttggca
cctgttagattgtctcagaaagaaccactaggcccaacagaggcaaagagagcccgtgga
cctgaagaagaggaaattgggagccctgagtccctagcagcttcagcctctgacacccag
aaactcagccccctacagaagctaagcaacatagacccagccatgctggagcgcctccta
agcttggaccgtctgctgggctcccaggggagccaggggacccctctgctgagcacccca
aggcgagagcgaatggtgctcatgaagacagtggaggagaaagacttggagattgagagg
cttaaagtgaaacaaaaggaactggaggccaaagtgctggcccaggaggctgcggacctg
aaggagaaggagaattgttctcccacaatgctccgaccccttgcccaccgcacagcccct
gtggctaagcccctgaaaaaagctgtggtgatgcccctacaactgctgcaggagcaggca
gcatccccaaataccgagatccatatcctgaaaaagaaaggccggaagaggaagctggag
tccctggatgcctctgaacctgaggagaaagctgaggactgctgggagccacagattagc
ccagagctgctggcccatgggcgccaaaaaatcttggacctgctgaacaaaggttcagcc
cgggatctccgcagcctgcagcgcatcggccagaagaaggcccagctcatcgtgggctgg
agggagctccacggccccttcagccaggtggaggacctggaacgcgtcgagggcatctcc
gggaaacagatggagtcattcctaaaggcgaacatcctgggcctcgccgcgggccagcgc
tgcggcccctcttga

DBGET integrated database retrieval system