KEGG   Loxodonta africana (African savanna elephant): 100655740
Entry
100655740         CDS       T04351                                 

Gene name
FOXO1
Definition
(RefSeq) forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04910  Insulin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100655740 (FOXO1)
   04152 AMPK signaling pathway
    100655740 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100655740 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100655740 (FOXO1)
   04922 Glucagon signaling pathway
    100655740 (FOXO1)
   04919 Thyroid hormone signaling pathway
    100655740 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    100655740 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    100655740 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655740 (FOXO1)
   05202 Transcriptional misregulation in cancer
    100655740 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100655740 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100655740 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100655740 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100655740 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100655740 (FOXO1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100655740 (FOXO1)
SSDB
Motif
Pfam: FOXO_KIX_bdg FOXO-TAD Forkhead
Other DBs
NCBI-GeneID: 100655740
NCBI-ProteinID: XP_023407128
LinkDB
Position
Unknown
AA seq 453 aa
HCSFALQNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKF
AKSRGRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNAST
ISGRLSPIMTQQDDLGDGDVHSMVYPPSAAKMASTLPSLSEISSPENMENLLDNLNLLSS
PTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSASPNYPKYTYGQSSLSPLPQMPMQTLQ
DNKSSYGGISQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQSNSRVLGQNVMMGPNSV
MPTYGSQVPHNKMMTPTSHTHPGHAQQTSAVNGRALPHAVSTMPHTSGMNRLTPGGKTPL
QVPLPHPMQMSALGGYSSGSSCHGYGRMGILHQEKLPSDLDGMFIERLDCDMESIIRNDL
MDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1362 nt   +upstreamnt  +downstreamnt
cattgctcttttgctttacagaactcaattcgtcataatctgtccctacacagcaagttc
atccgcgtgcagaatgaaggcaccgggaaaagttcttggtggatgctgaatccagaggga
ggcaagagtggaaaatccccccggagaagagctgcatccatggacaacaacagtaaattt
gctaagagccgaggccgagctgccaagaaaaaagcatcccttcagtctggccaggagggt
gctggggacagccctggttctcagttctccaagtggcctgctagccccggctctcacagc
aacgatgactttgataactggagtacatttcgccctcgaactagctcaaatgctagcact
attagtgggagactttctccaattatgacccaacaggatgaccttggagatggggatgtg
cattctatggtttatccaccatccgctgccaagatggcctctactctgcctagcctgtct
gagataagcagtcctgaaaacatggaaaaccttttggataatctcaacctcctctcctcg
ccgacatcattaactgtttcaacgcagtcttcacctggcaccatgatgcaacagacacca
tgctactcttttgcacctccaaacaccagtctgaattcagccagtccaaactacccaaaa
tacacttacggccagtccagcctgagccctttgccccagatgcctatgcaaacgctgcag
gacaacaaatcgagttacggagggataagtcaatataactgtgcaccgggactcctgaaa
gagttacttacttctgactctcctccccataatgacatcatgacaccagttgaccctggc
gtggcccagtccaacagccgggtcctgggccagaatgtgatgatgggccctaattcagtc
atgccaacctatggcagccaggtgcctcacaacaaaatgatgactcccacctcccatact
cacccaggacatgctcaacagacgtctgcagttaatgggcgtgccctgccccatgccgta
agcaccatgcctcacacctcaggcatgaaccgcctgaccccgggggggaagacacccttg
caagtgcctctgcctcaccccatgcagatgagcgccctggggggctactcctctgggagc
agctgccacggctatggcaggatgggcattctccaccaggagaagctcccgagtgacttg
gacggcatgttcatcgagcgcttggactgtgacatggagtccatcatccggaacgacctc
atggatggagatactttggattttaactttgacaatgtgttgcccaaccaaagtttcccg
cacagtgtcaagacgacgacgcatagctgggtgtcaggctaa

DBGET integrated database retrieval system