KEGG   Loxodonta africana (African savanna elephant): 100655765
Entry
100655765         CDS       T04351                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1
  KO
K02157  axin 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100655765 (AXIN1)
   04390 Hippo signaling pathway
    100655765 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100655765 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655765 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100655765 (AXIN1)
   05225 Hepatocellular carcinoma
    100655765 (AXIN1)
   05226 Gastric cancer
    100655765 (AXIN1)
   05217 Basal cell carcinoma
    100655765 (AXIN1)
   05213 Endometrial cancer
    100655765 (AXIN1)
   05224 Breast cancer
    100655765 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100655765 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100655765 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100655765 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100655765 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100655765 (AXIN1)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100655765 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind CAMSAP_CC1
Other DBs
NCBI-GeneID: 100655765
NCBI-ProteinID: XP_003417848
LinkDB
Position
Unknown
AA seq 833 aa
MMTAPEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPVSNTFCLGKGARPKGETTST
ATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEDCADLLDFW
FACSGFRKLEPCDSNEEKRLKLAKAIYRKYILDSNGIVSRQTKPATKSFIKDCIMRQQID
PATFDQAQTEVQSTMEENTYPSFLKSDIYLEYTQTGSESPKVCSDQSSGSGTGKGVSGYL
PTLNEDEEWMCDQDVEIEDSRGTAPSSRLTQKLLMETAAQRTSSCRRSSEGRELRHGSWR
EPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGVPPYRIRKQHRREMQE
SVQVNGRVPLPHIPRTYRMPKEVRVEPHKFAAELIHRLEAVQRTREAEEQLEERLRRVRM
EEEGEDVDAVPGSLGMGHKLPPAQAWHHFPPRYADAGCAGPRDTHDEDPESILDEHVQRV
LRTPGRQSPGPGHRSPDSGHATRLPAVLGGVAGHGKHTTKAGAKVDAAGLYHHRHVHHHV
HHSMVKPKEQIEAEAAHRVQSSFPWSPELHGYTTKPRGFSESVGAAPTATDSLGYSGKAS
ASSKRIAKKAEASRGVATSEVPGSPEGAEKMQTILQWIIEGEKEISRHKKAGHGPSGAKR
QQAHESARPLSIERPGTVHPWVSAQLRNSIQPSHLFIQDPTMPPNPAPNPLTQLEEARRR
LEEEEKRTSKLLAKQRTKSQKKAGGVSAPPCDSIVVAYYFCGEPIPYRTLVKGRGVTLGQ
FKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDQAILPVFEEKIIGKVEKVD
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgatgactgccccagagcagggcttccccctggaccttggcgcgagcttcactgaagat
gcgcccaggccccctgtgccgggtgaggagggagagttggtgtccactgacccgaggcca
gtcagcaatactttctgcttggggaaaggtgccaggcccaaaggggagacgacgtccaca
gccactccgcggcgctccgacctggacctgggctatgagcctgaaggcagcgcctcgccc
acacctccgtacctgaagtgggctgagtcactacactccctactggatgaccaggatggg
atacacctgttcaggactttcctgaagcaggaggactgtgctgacctgctagacttctgg
tttgcctgcagtggcttccggaagctggagccctgtgactccaatgaggagaagaggctg
aagctggccaaggccatctataggaagtacatcctggacagcaatgggatcgtgtcccgg
cagacgaagccagccaccaagagcttcatcaaggactgcatcatgaggcagcagatcgac
cccgccaccttcgaccaggcccagacggaggtccagtccaccatggaggagaacacctac
ccttcattcctcaagtctgacatttatctggaatacacgcagacaggctccgagagcccc
aaggtctgcagtgaccagagctcggggtcggggacagggaagggcgtgtctgggtacctg
cctaccttgaatgaggatgaggagtggatgtgcgaccaggacgtggagatcgaggactcc
aggggcaccgccccctccagcagacttacccagaagctgctcatggagacggccgcccag
cgcacctcctcatgccggcggagcagtgaaggcagggagctcaggcatggatcctggcgg
gagccggtcaacccctactatgtcaactctggctatgccttggccccagccacaagtgcc
aatgacagcgagcagcagagcctgtcgagcgatgccgacaccctgtccctcactgacagc
agtgtggatggcgtccccccgtacaggatccgcaagcagcatcgccgggagatgcaggag
agcgtccaggtcaacggacgggtgcctctgcctcacatccctcgcacttaccggatgcca
aaggaggtccgtgtggagccacacaagttcgctgctgagctcatccaccgcctggaggcc
gtgcagcgcacgcgggaggctgaggaacagctggaggagcggctgcggcgtgtgcggatg
gaggaggagggtgaagacgtggatgcagtccctggcagcctggggatgggccacaaactg
cctcctgcccaggcctggcaccacttcccgccacgctatgcagacgcaggctgtgccggg
ccacgggacacacatgacgaggaccctgagagcatcctggatgagcacgtgcagcgtgtc
ctgcgcacgcctggccgccagtctcctgggcctggtcaccgctcccctgacagtgggcat
gcaaccaggctgcctgcagtgttgggtggagtggccgggcacggcaaacacacaaccaag
gcaggtgcaaaggtggacgcagctggcctataccaccataggcatgtccaccaccatgtg
caccacagcatggtgaagcccaaggagcagatcgaggcagaggctgcccaccgagtccag
agcagcttcccgtggagcccagagctgcacggctacactacaaaacctcgcggcttctct
gagagtgtgggtgccgcccccaccgctaccgacagcctgggctatagcggaaaggcaagt
gcgtcctctaagaggatagccaagaaagctgaggctagccggggcgtggccacctcggag
gtgcctggctcgcctgagggtgcggagaagatgcagacgatcctgcagtggatcatcgaa
ggggagaaggagatcagcaggcacaagaaagccggccacgggccttccggggccaagagg
cagcaggcccacgagagtgccaggcccctgtccatcgaacgccctggcactgtgcacccc
tgggtcagtgcccagcttcggaactccatccagccctcccacctcttcatccaagacccc
actatgcccccgaatcctgcacccaaccccctgacccagctggaggaggcccgcaggcgt
ctggaggaagaggagaagcgaaccagcaaactgctcgccaagcagaggacgaagtcacag
aagaaggcgggcggcgtgagtgccccgccgtgcgatagcattgtcgtggcctactacttc
tgtggggagccaattccctaccggaccctggtgaaaggccgtggggtcaccctgggccag
ttcaaggagctgctgaccaagaagggcagttacagatactacttcaagaaagtgagtgat
gagtttgactgtggtgtagtgtttgaagaggtgcgggaggaccaggccattctgcctgtc
tttgaggaaaagataatcggcaaggtggagaaggtggactga

KEGG   Loxodonta africana (African savanna elephant): 100663921
Entry
100663921         CDS       T04351                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2
  KO
K04385  axin 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100663921 (AXIN2)
   04390 Hippo signaling pathway
    100663921 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100663921 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663921 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100663921 (AXIN2)
   05225 Hepatocellular carcinoma
    100663921 (AXIN2)
   05226 Gastric cancer
    100663921 (AXIN2)
   05217 Basal cell carcinoma
    100663921 (AXIN2)
   05213 Endometrial cancer
    100663921 (AXIN2)
   05224 Breast cancer
    100663921 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100663921 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100663921 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100663921 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100663921 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100663921 (AXIN2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100663921 (AXIN2)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD DUF4827
Other DBs
NCBI-GeneID: 100663921
NCBI-ProteinID: XP_003417255
LinkDB
Position
Unknown
AA seq 708 aa
MSSAALVTRLPDPSSSFREDAPRPPVPGEEGETPPCQAGLGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSSGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATANVRSTEAVENGYRSFKRSDSVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPAIFAAELISRLEKLKLELESRHSLEERLQQIREVVLGRHLHPWAGALLLLRKC
KSHPKMPESMPGEPFGSSRGSTLPKRSGKGTEPGLALPIREGGAPGGAGAPQLPGEEGDR
SQDVWQWMLESERQSKAKPHSAQSTKKAYSGESARVASSERAGRHHLWGASNGHPRTVPR
AHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPSKQRCCVASQQRDRNHPAPGQAGTT
PFSTPALAPEDHKEPKKLAGVHPLQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQL
SKKGNYRYYFKKASDEFACGAVFEEIWDDDTMLPMYEGRILGKVERID
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgagtagcgctgcgttggtgactcgcctcccggacccaagcagtagcttccgcgaggat
gccccacggcccccagtccctggggaggaaggggagaccccgccgtgccaagctggcctg
ggcaagggccaggtcaccaaacccatgcctgtgtcctccaatactaggcggaacgaggat
gggctgggggaaccagaggggcgggcttccccggattctcctctgaccaggtggaccaag
tctttgcactccttgttgggtgatcaagacggggcttatctcttccggactttcttggaa
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcattgtctccaagcagctgaaacctgccaccaagacctacatccgcgatggc
atcaagaagcagcagattgactccatcatgtttgaccaggcacagactgagatccagtca
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcgtacatgagcagtgggggactagggagcctgaaggtc
gtgtgtggctatctccccaccttgaatgaagaagaagagtggacgtgtgccgacttcaaa
tgcaaactctcgccaacggtggttggcttgtccagcaaaactctgagggccacagcgaac
gtgaggtccacggaagcagttgaaaatggatacaggtccttcaagaggagcgattccgtt
aatccataccacgtaggttctggctatgtctttgcgcctgccaccagtgcaaatgacagt
gagatctccagtgatgcactgactgatgattccatgtccatgacggacagtagcgtagat
ggaatccctccgtaccgcgtggggagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaacctgccatctttgcagccgagctgatctccaggctggagaag
ctgaagctagagctggagagtcgtcacagcctggaggagcggctgcagcagatcagagag
gtagtgctgggccgccacctccacccttgggccggggcgctattactgctacgcaagtgc
aagagccaccccaagatgccggagtcgatgccgggggagccatttggcagcagcagaggc
agtaccttgcccaaacggagtgggaaaggcacggagccaggcctggccctgcccatcagg
gaaggaggggccccaggtggggctggggcgccgcagcttcctggggaggaaggagacagg
tcgcaggatgtctggcagtggatgctggagagcgagcggcagagcaaggccaagccccat
agtgcccaaagcaccaaaaaagcctactctggggagtctgcccgagtagcttccagtgag
cgagccggccggcaccatctgtggggggccagcaatgggcacccccgcactgtcccccga
gcccacccgttcacccaggaccctgccatgcctcccctgaccccacccaacaccctggca
cagctggaggaggcctgccgcaggctggctgaggtgtcgaagccctcaaaacagcggtgc
tgcgtagccagtcagcagagggacagaaaccacccggcccctgggcaggcaggaactacg
cccttctccaccccagccctggctcctgaagatcacaaagagccaaagaagctggcgggt
gtccacccgctgcaggccagtgaactggttgtcacttactttttctgtggagaagaaatt
ccatacaggaggatgctgaaggcccagagcttgaccctgggccacttcaaagagcagctc
agcaaaaagggaaattataggtattatttcaaaaaagcaagcgacgagtttgcctgcgga
gcggtgtttgaggagatctgggatgatgatacaatgctccccatgtatgaagggaggatc
ctgggaaaggtggagaggatcgattga

DBGET integrated database retrieval system