KEGG   Loxodonta africana (African savanna elephant): 100656200
Entry
100656200         CDS       T04351                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2 isoform X1
  KO
K03099  son of sevenless
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04068  FoxO signaling pathway
lav04072  Phospholipase D signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04540  Gap junction
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04714  Thermogenesis
lav04722  Neurotrophin signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05034  Alcoholism
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656200 (SOS2)
   04012 ErbB signaling pathway
    100656200 (SOS2)
   04014 Ras signaling pathway
    100656200 (SOS2)
   04630 JAK-STAT signaling pathway
    100656200 (SOS2)
   04068 FoxO signaling pathway
    100656200 (SOS2)
   04072 Phospholipase D signaling pathway
    100656200 (SOS2)
   04151 PI3K-Akt signaling pathway
    100656200 (SOS2)
   04150 mTOR signaling pathway
    100656200 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100656200 (SOS2)
   04540 Gap junction
    100656200 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100656200 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100656200 (SOS2)
   04660 T cell receptor signaling pathway
    100656200 (SOS2)
   04662 B cell receptor signaling pathway
    100656200 (SOS2)
   04664 Fc epsilon RI signaling pathway
    100656200 (SOS2)
   04062 Chemokine signaling pathway
    100656200 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100656200 (SOS2)
   04912 GnRH signaling pathway
    100656200 (SOS2)
   04915 Estrogen signaling pathway
    100656200 (SOS2)
   04917 Prolactin signaling pathway
    100656200 (SOS2)
   04926 Relaxin signaling pathway
    100656200 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    100656200 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100656200 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100656200 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656200 (SOS2)
   05206 MicroRNAs in cancer
    100656200 (SOS2)
   05205 Proteoglycans in cancer
    100656200 (SOS2)
   05231 Choline metabolism in cancer
    100656200 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100656200 (SOS2)
   05225 Hepatocellular carcinoma
    100656200 (SOS2)
   05226 Gastric cancer
    100656200 (SOS2)
   05214 Glioma
    100656200 (SOS2)
   05221 Acute myeloid leukemia
    100656200 (SOS2)
   05220 Chronic myeloid leukemia
    100656200 (SOS2)
   05211 Renal cell carcinoma
    100656200 (SOS2)
   05215 Prostate cancer
    100656200 (SOS2)
   05213 Endometrial cancer
    100656200 (SOS2)
   05224 Breast cancer
    100656200 (SOS2)
   05223 Non-small cell lung cancer
    100656200 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    100656200 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100656200 (SOS2)
   05160 Hepatitis C
    100656200 (SOS2)
   05163 Human cytomegalovirus infection
    100656200 (SOS2)
   05165 Human papillomavirus infection
    100656200 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100656200 (SOS2)
   01522 Endocrine resistance
    100656200 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100656200 (SOS2)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100656200 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 100656200
NCBI-ProteinID: XP_023401915
LinkDB
Position
Unknown
AA seq 1330 aa
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEDLIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQED
DIGLVSLCEDEPSSSGELNYYDLVRAEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSD
IEKIFSNISDIHELTVKLLGLIEDAVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILSPKFNEHFSKLMARPAVAVHFQSISDGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLK
ACSEEQEDGECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHVFLFDGLMISCKPNHGQSRLP
GYNNAEYRLKEKFVMRKTQVCDKEDTCECKHAFELISKDENSIIFAAKSAEEKNNWMAAL
ISLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPII
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKL
AIEKGEQPISADLKRFRKEYIQPVQLRVLNVFRHWVEHHFYDFERDLELLERLESFISSV
RGKSMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQSETFDLMTLHP
IEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAVLSRIIEVLQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRIL
DEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKGGKDLINFSKR
RKVAEITGEIQQYQNQPYCLRIEPEIRRYFENLNPMGSASEKEFTDYLFNKSLEIEPRNC
KQPTRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELEST
MSAPTSPNTPSTPPVSASSELSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKL
SEEPLVPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPAPSGAFDGP
LHSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPMGHLHRDVRDASTSPNSPNTP
PSTPSPRVPRRCHVLSSNHNNLPHPPAPPVPPRQNSGPHLPKLPPKTYKRELSHPPLYRL
PLLENAETPQ
NT seq 3993 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtacgagttcttcagcgaagagaatagcccgaaatggcgg
ggactgttggtctcggctctgcgaaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagacctgatttttcaactgcttaataaattatgc
atggcccaaccaaggacagttcaagatgtggaggaacgagttcaaaagacctttccccat
ccgattgataaatgggctattgctgatgcacaatctgccatagaaaaacgaaaacgaaga
aatcctctcttactgcctgtggacaaaatccatccttcattaaaggaagttttaggatac
aaagtagactaccatgtctccttatatattgtggctgtactagagtatatctcagctgat
attttgaaactggctggtaattatgtttttaatatccggcattatgagatatctcagcag
gacattaaagtgtcaatgtgtgcagacaaggttttgatggacatgttcgatcaggaggat
gacataggtttggtttctctctgtgaagatgaacctagttcctcaggtgaattaaactac
tatgaccttgtcagagctgaaattgcagaagaaagacagtatttacgggaactaaatatg
atcataaaagtatttcgagaagccttcctttctgacagaaagctgtttaaaccttctgat
attgaaaagattttcagtaacatttcagatatccatgaattgaccgtgaaacttttaggc
ttgattgaagacgcagttgagatgactgacgaaagcagtccacatcccttagctggcagc
tgttttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggac
atcctttcacccaagtttaatgaacatttcagtaagttgatggctagaccggcagttgct
gtacactttcagtctatttctgatgggtttaaagaggcagttcgttatgtccttccacgc
cttatgctggtgccggtgtaccattgttggcactattttgaattattaaagcaattgaaa
gcgtgtagtgaagagcaagaagatggagaatgtttgaaccaagctattactgctctcatg
aatctccaaggtagtatggaccgaatttacaagcagtattcacctagacgccgacctggg
gatcctgtttgcccattttataatcgtcaattaagaagcaagcacctggctatcaaaaaa
atgaatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgt
aatgaattcataatggaaggtccattgacaagaattggtgctaaacatgaacgccatgtt
tttctctttgatggcttaatgattagctgtaaacctaatcatggccagtccaggcttcca
ggttataataatgcagaatacagattaaaagaaaaatttgtcatgaggaaaacacaagtt
tgtgataaagaagatacttgtgagtgcaaacatgcttttgaattaatatccaaagatgaa
aacagcataatatttgctgctaagtctgctgaagagaaaaataattggatggcagcactt
atttctcttcagtatcgtagtactctagatcgaatgctagattcagttttattgaaagaa
gaaaatgagcaaccactgagattgccaagtccggaagtatatcgttttgtggtaaaagac
tctgaggaaaatattgtttttgaagacaacttgcagagtagaagtggaatccccattatt
aaaggcggaactgtggtgaaattaattgaaaggttaacatatcatatgtatgcagatcct
aattttgttcgtacttttcttactacataccgctcgttttgtaaaccacaggaattgcta
agcttactgattgaacggtttgaaattccggagccagaacctactgaagcagacaaatta
gcaatagaaaaaggcgagcagccaatcagtgcagaccttaaaaggtttcgaaaggaatac
atccagccagtacaacttagggtcttaaatgtgttccggcattgggttgaacatcatttt
tatgactttgaaagagatttggagttgcttgaaagactagaatccttcatttcaagtgta
agagggaaatctatgaagaaatgggtggaatcaattgctaagatcatcaagagaaagaaa
caggctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaatt
gaatggcatatcagcagaccaggacagtctgaaacatttgatcttatgacacttcatcca
atagaaattgcacgccagctaacacttctggaatctgatctttatcggaaagtccaacct
tctgaacttgtgggaagtgtatggaccaaagaagataaggaaataaattctccaaactta
ttaaaaatgattcgccataccacaaatctcactctctggtttgaaaagtgcattgtggaa
gcagaaaattttgaagaacgggtggcagtactaagtagaattattgaagttctgcaagtt
tttcaagatttgaataatttcaatggtgtattggagatagtcagtgcagtaaattcagtg
tcagtgtacagactagaccatacgtttgaggcattgcaggaaagaaagcggagaattttg
gatgaagctgtggaattaagtcaagatcactttaaaaaatacttagcaaaacttaagtca
atcaatccaccttgcgtgcctttttttggaatatatttaacaaatattctgaaaactgaa
gaagggaataatgattttttaaaaaagggaggaaaagatttaatcaatttcagtaagagg
cggaaagtagctgaaataactggagaaattcagcagtatcagaatcaaccttactgttta
cggatagaaccagaaataaggaggtactttgaaaaccttaaccccatgggaagtgcatct
gaaaaagagtttactgattatttgttcaacaagtcattagaaattgagcctcgaaactgc
aaacagccaactcgatttcctaggaaatcaactttctccttaaaatctcctggaataagg
ccaaatgcaggccgacatggctctacctcaggcactttacgaggtcatccaacaccatta
gaaagagaaccatgcaaaataagctttagtcgcattgctgaaaccgagcttgaatcaaca
atgtcggcaccaacctctccaaatacaccatctactccaccagtatctgcttcctcagaa
cttagtgtgtttttagatgtggatctcaacagttcctgtggcagcaatagcatctttgct
ccagtcctcttgccacattcaaagtctttcttcagttcatgcggtagtttacataaacta
agtgaagagccactggttcctcctcctcttcctcctcgaaaaaagtttgaccacgatgct
tcaaattccaagggaaatatgaaatctgatgatgacccccctgctattccaccaagacag
ccgcctcctccaaaggtaaaacctagagttcctgctcctagtggtgcatttgatgggcct
ctacatagtccacctccaccgccgccaagagatcctcttcctgatactcctccaccagtt
ccccttcggcctccagaacacttcataaactgtccatttaatcttcagccacctccaatg
ggacaccttcacagagatgtcagagacgctagtacgagtccaaattcaccaaacactcct
cctagcacaccctctccgagggtaccacgtcgatgccatgtgctcagttctaatcacaat
aatcttcctcatcctccagctccccctgttccaccaaggcagaattcaggccctcaccta
cccaaactgccaccaaagacttacaaacgggagctgtcgcaccccccattgtacagatta
cctttgctggaaaatgcggaaactcctcagtga

KEGG   Loxodonta africana (African savanna elephant): 100657379
Entry
100657379         CDS       T04351                                 

Gene name
SOS1
Definition
(RefSeq) LOW QUALITY PROTEIN: son of sevenless homolog 1
  KO
K03099  son of sevenless
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04068  FoxO signaling pathway
lav04072  Phospholipase D signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04540  Gap junction
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04714  Thermogenesis
lav04722  Neurotrophin signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05034  Alcoholism
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100657379 (SOS1)
   04012 ErbB signaling pathway
    100657379 (SOS1)
   04014 Ras signaling pathway
    100657379 (SOS1)
   04630 JAK-STAT signaling pathway
    100657379 (SOS1)
   04068 FoxO signaling pathway
    100657379 (SOS1)
   04072 Phospholipase D signaling pathway
    100657379 (SOS1)
   04151 PI3K-Akt signaling pathway
    100657379 (SOS1)
   04150 mTOR signaling pathway
    100657379 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100657379 (SOS1)
   04540 Gap junction
    100657379 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100657379 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100657379 (SOS1)
   04660 T cell receptor signaling pathway
    100657379 (SOS1)
   04662 B cell receptor signaling pathway
    100657379 (SOS1)
   04664 Fc epsilon RI signaling pathway
    100657379 (SOS1)
   04062 Chemokine signaling pathway
    100657379 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100657379 (SOS1)
   04912 GnRH signaling pathway
    100657379 (SOS1)
   04915 Estrogen signaling pathway
    100657379 (SOS1)
   04917 Prolactin signaling pathway
    100657379 (SOS1)
   04926 Relaxin signaling pathway
    100657379 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    100657379 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100657379 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100657379 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657379 (SOS1)
   05206 MicroRNAs in cancer
    100657379 (SOS1)
   05205 Proteoglycans in cancer
    100657379 (SOS1)
   05231 Choline metabolism in cancer
    100657379 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100657379 (SOS1)
   05225 Hepatocellular carcinoma
    100657379 (SOS1)
   05226 Gastric cancer
    100657379 (SOS1)
   05214 Glioma
    100657379 (SOS1)
   05221 Acute myeloid leukemia
    100657379 (SOS1)
   05220 Chronic myeloid leukemia
    100657379 (SOS1)
   05211 Renal cell carcinoma
    100657379 (SOS1)
   05215 Prostate cancer
    100657379 (SOS1)
   05213 Endometrial cancer
    100657379 (SOS1)
   05224 Breast cancer
    100657379 (SOS1)
   05223 Non-small cell lung cancer
    100657379 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    100657379 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100657379 (SOS1)
   05160 Hepatitis C
    100657379 (SOS1)
   05163 Human cytomegalovirus infection
    100657379 (SOS1)
   05165 Human papillomavirus infection
    100657379 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100657379 (SOS1)
   01522 Endocrine resistance
    100657379 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100657379 (SOS1)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100657379 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 PH_13 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 100657379
NCBI-ProteinID: XP_003416139
LinkDB
Position
Unknown
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPALESNDDALQYVEELILQLLNMLC
QAQPRSVLDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINVLSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSTN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDHFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEXNVQPKAGIPI
IKAGPVIXLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPSVEWHISRPGHTETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPSTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKMMSKHLDSPPAIPPRQPTSKVYSPRYSMSD
RTSVSDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaagagaacgcgcccaagtggcgg
gggctgctggtgccagcgctgaagaaggtccaagggcaagttcatccagcacttgagtct
aatgatgatgctcttcagtatgttgaagaattaattttgcagttattgaatatgctgtgc
caggctcagccccgaagtgttctagatgtagaggaacgtgttcagaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccagtcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttattaaaggaagtcctaggttat
aaaattgaccaccaagtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaagctggcggggaattatgtacgaaatatacggcactatgaaattacaaaacaa
gatattaaagtggcaatgtgtgccgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatgtattatctttaactgatgaagaaccttccacttcaggagagcaaact
tattatgatttggtaaaagcatttatggcagaaattcgacaatatataagggagctaaat
ctaattataaaagtttttagagagccttttgtctccaattcaaaattgttttcaactaat
gatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgtaaagttactg
ggccacatagaagacactgtagaaatgacagatgaaggcagtccccatccattagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattttgcgacctggttttcatgatcatttccttagtcagttgtcaaagcctggagcg
gcactctatttgcagtcaataggcgaaggtttcaaagaagctgttcagtatgttttaccc
aggctgcttctagctcctgtttaccactgtctgcattactttgaacttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaagaatgtttgaaacaagcgataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgagtctgcatgtcggttttacagccaacaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgaatttataatggaaggaactctgacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaaccatgggcagccaagactt
cctggggctagcaatgcagaatatcgtctgaaagaaaagttctttatgagaaaggtacaa
attaatgacaaagatgacacgaatgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaactggatggcagca
ttgatatctttacagtaccggagcaccctggaaaggatgctcgatgtgacaatgctacag
gaagagaaggaggagcagatgaggcttcctagtgctgatgtttatagatttgcagagccc
gactctgaagagaatataatatttgaangaaacgtgcagcccaaggctggaattccaatt
atcaaggctggacctgtcattnaacttatagagaggcttacataccatatgtacgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgcaaacctcaggaacta
ctgagtcttattatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcaaccccttagtgcagaattgaaaaggtttaggaaagaa
tatatacagcctgtacaacttcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctatgatttcgaaagagatgcagatcttctgcagcgaatggaagaatttattggaaca
gtaagaggtaaagcaatgaagaaatgggttgaatccatcactaagataatccaaaggaaa
aaaattgcaagagacaatgggccaggtcataatattacatttcagagttcacctcccagt
gttgagtggcatataagcagacctgggcacacagagacttttgacctgctcacgttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctctaccgggctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
cttctgaaaatgatccggcacaccactaacctcactctgtggtttgagaagtgtattgta
gaaactgaaaacttagaagaacgagtagcagtggtgagtcgaataattgagattctacaa
gtctttcaggagctgaacaactttaatggtgtcctcgaggttgttagtgctatgaactca
tcacctgtttacagactagaccacacatttgagcaaataccaagtcgccagaagaaaatt
ttagaagaagctcatgaattgagtgaagatcactataaaaaatacttggcaaaactcagg
tctattaacccaccatgcgtgcctttttttggaatttatttaactaacatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaagacatggaaaagaacttataaactttagcaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttactgt
ttacgagtagaatcagatatcaaaaggttctttgaaaacttgaatccaatgggaaatagc
atggaaaaggaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccgagatttcccaaaaaatacagctatcccttaaaatctcctggtgtc
cgtccatcaaacccaagacccagtaccatgcgacaccccacacctctgcagcaggagcca
aggaagatcagttatagtcggatccccgaaagtgagaccgaaagcacagcgtccgcacca
aattctccaagaacaccgttaactcctcctcctgcatctggtgcttccagcaccacggac
gtttgcagcgtctttgattctgatcattcaagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagggcactgacgaggtgcctgtcccccctcctgttcctccacgaagacgaccagaa
tctgccccggcggaatcttcgccatctaagatgatgtctaagcatttggacagtccccca
gcaatccctcctaggcaacctacatcaaaagtctattcaccacggtactcaatgtcagac
cggacctctgtgtcagaccctcctgaaagccctcccttattgccaccacgagaacctgtg
aggacacctgatgttttctcaagctcaccactgcatctccagcctccccctttgggcaaa
aaaagtgaccacggcaatgcgttcttcccaaacagcccgtcccccttcacaccgccgcct
cctcaaaccccttctcctcatggcacgagaaggcatctgccatcaccaccactgacacaa
gaagtggaccttcattccattgctgggccgcccgttcctccacgacaaagcacttctcag
catatccctaagctccctccaaaaacttacaaaagggagcacacacacccatccatgcac
agagacggaccgccactgttggagaatgcccactcttcctga

DBGET integrated database retrieval system