KEGG   Loxodonta africana (African savanna elephant): 100656201
Entry
100656201         CDS       T04351                                 

Gene name
KCNMA1
Definition
(RefSeq) calcium-activated potassium channel subunit alpha-1 isoform X6
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04911  Insulin secretion
lav04924  Renin secretion
lav04970  Salivary secretion
lav04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100656201 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100656201 (KCNMA1)
   04924 Renin secretion
    100656201 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100656201 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    100656201 (KCNMA1)
   04972 Pancreatic secretion
    100656201 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100656201 (KCNMA1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100656201 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 100656201
NCBI-ProteinID: XP_010587555
LinkDB
Position
Unknown
AA seq 1221 aa
MANGGGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSVHEPKMDALIIPVT
MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKINNG
SSQADGTLKPVDEKEETVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVI
YFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFT
VPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTA
AGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFIL
GGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRD
DVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKY
CADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAEL
KLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLS
FPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAF
FYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDA
LGRAFPLSSVSVNCSTSFCAFEDEQPSTLSPKKKQRNGGMRNSPSSSPKLMRHDPLLIPG
NDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALI
GLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAV
NINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMD
RSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACG
TAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANR
DRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRY
VITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVHSIPSTANR
ANRPKSREARDKQNRKEMVYR
NT seq 3666 nt   +upstreamnt  +downstreamnt
atggcaaatggtggcggcggcggcggcggcggcggaggcagcagtcttagaatgagtagc
aatatccacgcgaaccatctaagcctagacgcgtcctcctcctcttcttcttcctcctcc
tcttcctcctcgtcctcggtccacgagcccaagatggatgcgctcatcatcccggtgacc
atggaggtgccgtgcgacagccggggccagcgcatgtggtgggctttcctggcctcctcc
atggtgacttttttcgggggcctcttcatcatcttgctctggcggacgctcaagtacctg
tggaccgtttgctgccactgcgggggcaagacgaaggaggcccagaagattaacaatggc
tcaagccaggctgatggcactctcaagcccgtggatgaaaaagaggagacggtggcggcc
gaggtcggctggatgacctccgtgaaagactgggcgggggtgatgatatcagcccagacg
ctgactggcagagtcctggttgtcttagtttttgccctcagcattggtgcacttgtaata
tacttcatagattcgtcaaacccaatagaatcctgccagaatttctacaaagatttcaca
ttacagatcgacatggctttcaacgtgttcttccttctctactttggcttgcggtttatt
gcagccaacgataagctgtggttctggctggaagtgaactctgtagtggatttcttcacg
gtgcccccggtgtttgtgtctgtgtacttaaacagaagctggcttggtttgagattttta
agagctctcagactgatacagttttcagaaatcttgcagtttctgaatatcctgaaaaca
agtaattccatcaagctggtgaatctgctgtccatatttatcagcacgtggctaacagca
gccgggttcatccatttggtggagaattcaggggacccatgggaaaacttccaaaacaac
caggctcttacatactgggagtgtgtctatttactgatggtgaccatgtccaccgtcggc
tacggcgatgtttatgcaaaaaccacacttggccgcctgttcatggtcttcttcatcctc
gggggactggccatgtttgccagctacgtccctgaaatcatagagttaataggaaaccgc
aagaaatacgggggctcctatagtgcggttagtggaagaaagcacattgtggtctgtgga
cacatcactctggagagtgtttccaacttcctgaaggactttctgcacaaggaccgggac
gatgtcaacgtggagattgtctttcttcacaacatttcccctaacctggagcttgaagct
ctgttcaaacggcattttactcaggtggaattttatcagggctcagtcctcaatccacat
gatcttgcgagagtcaagatagagtcagcagatgcgtgcctgatccttgccaataagtac
tgcgctgacccggatgctgaagatgcttccaacatcatgagagtcatctccataaagaac
taccatccgaagatcagaatcatcacccagatgctgcagtatcacaacaaggcccatctg
ctgaatatcccgagctggaattggaaagagggggatgatgcgatctgccttgcagagctg
aagctgggtttcatagcccagagctgcctggctcaaggcctctccacgatgctggccaac
ctcttctccatgaggtcattcataaagattgaggaagacacgtggcagaaatattacttg
gaaggagtctccaatgaaatgtacacagaatatctctccagtgccttcgtgggtctgtcc
ttccctaccgtttgtgagctgtgttttgtgaagctcaagctcctaatgatagccattgag
tacaagtctgccaaccgagagagccgtatattaattaatcctggaaaccaccttaagatc
caagaaggtactttaggatttttcatcgcaagtgatgccaaagaagttaaaagggcgttt
ttttactgcaaggcctgtcacgatgacatcacagatcccaaaagaataaaaaaatgcggc
tgcaaacgtcccaagatgtccatctacaagagaatgagacgggcatgttgttttgattgc
ggacgttctgagcgtgactgctcgtgcatgtcaggccgtgtgcgtggtaacgtggacgcc
ctggggagagccttcccactttcttctgtctctgttaattgctccaccagtttctgtgcc
tttgaagatgaacaaccgtccacgctgtcaccgaaaaaaaagcaacggaatggcggcatg
aggaactcacccagctcctcgcccaagctgatgaggcatgaccctttgttaattcctggc
aatgatcagattgacaacatggactccaatgtgaagaagtatgactctactgggatgttt
cactggtgtgctcccaaggaaatagagaaggtcattctgactcgcagcgaagccgccatg
accgtgctgagtggccacgttgtggtctgcatcttcggcgatgtcagttcagccttgatt
gggctccggaacctggtgatgccgctccgtgccagcaacttccattaccacgagctcaag
cacattgtgtttgtgggctccattgagtacctcaagcgggaatgggagacgcttcacaac
ttccccaaagtgtccatattgcctggtacaccattaagtcgggctgatttaagggccgtc
aacatcaacctctgtgacatgtgcgttatcctgtcagccaatcagaataatattgatgat
acttcgctgcaggacaaggaatgcatcttggcgtcactcaacatcaaatctatgcagttt
gatgacagcattggggtcttgcaggctaattcccaagggttcacacctccaggaatggac
agatcctctccagataacagcccagttcacgggatgttacggcagccatccatcacaact
ggggtcaatatccccatcatcactgaactagtgaatgataccaatgttcagtttttggac
caagacgatgacgatgaccctgacacagaactgtacctcacacagccgtttgcatgtggg
acagcgtttgcagtcagcgtcctggactctctcatgagtgcgacctatttcaatgacaat
atccttaccctgatacggaccctggtgactggaggagccacaccagagctcgaagctctg
attgctgaggagaatgcacttcgagggggctatagcaccccccagacgctggccaacagg
gaccgctgccgtgtggcccagttagccctgctggatggtccctttgctgacttaggggat
ggcggttgttatggtgatctcttctgcaaagctctgaaaacctataatatgctttgtttt
gggatttaccggctgagagatgcacacctcagcacccccagccagtgcacgaagaggtat
gtcatcaccaaccccccatacgaatttgagctcgtgcccacggacctgatcttctgcttg
atgcagtttgaccacaacgccggccagtcccgagccagcctgtcccattcctcccactcg
tcccagtcctctagcaagaagagttcctccgttcactccatcccgtccacagccaaccga
gcgaaccgccccaagtccagggaggcccgggacaaacagaacagaaaagaaatggtttac
agatga

DBGET integrated database retrieval system