KEGG   Loxodonta africana (African savanna elephant): 100656201
Entry
100656201         CDS       T04351                                 

Gene name
KCNMA1
Definition
(RefSeq) calcium-activated potassium channel subunit alpha-1 isoform X6
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04911  Insulin secretion
lav04924  Renin secretion
lav04970  Salivary secretion
lav04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100656201 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100656201 (KCNMA1)
   04924 Renin secretion
    100656201 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100656201 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    100656201 (KCNMA1)
   04972 Pancreatic secretion
    100656201 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100656201 (KCNMA1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100656201 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 100656201
NCBI-ProteinID: XP_010587555
LinkDB
Position
Unknown
AA seq 1221 aa
MANGGGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSVHEPKMDALIIPVT
MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKINNG
SSQADGTLKPVDEKEETVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVI
YFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFT
VPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTA
AGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFIL
GGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRD
DVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKY
CADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAEL
KLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLS
FPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAF
FYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDA
LGRAFPLSSVSVNCSTSFCAFEDEQPSTLSPKKKQRNGGMRNSPSSSPKLMRHDPLLIPG
NDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALI
GLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAV
NINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMD
RSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACG
TAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANR
DRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRY
VITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVHSIPSTANR
ANRPKSREARDKQNRKEMVYR
NT seq 3666 nt   +upstreamnt  +downstreamnt
atggcaaatggtggcggcggcggcggcggcggcggaggcagcagtcttagaatgagtagc
aatatccacgcgaaccatctaagcctagacgcgtcctcctcctcttcttcttcctcctcc
tcttcctcctcgtcctcggtccacgagcccaagatggatgcgctcatcatcccggtgacc
atggaggtgccgtgcgacagccggggccagcgcatgtggtgggctttcctggcctcctcc
atggtgacttttttcgggggcctcttcatcatcttgctctggcggacgctcaagtacctg
tggaccgtttgctgccactgcgggggcaagacgaaggaggcccagaagattaacaatggc
tcaagccaggctgatggcactctcaagcccgtggatgaaaaagaggagacggtggcggcc
gaggtcggctggatgacctccgtgaaagactgggcgggggtgatgatatcagcccagacg
ctgactggcagagtcctggttgtcttagtttttgccctcagcattggtgcacttgtaata
tacttcatagattcgtcaaacccaatagaatcctgccagaatttctacaaagatttcaca
ttacagatcgacatggctttcaacgtgttcttccttctctactttggcttgcggtttatt
gcagccaacgataagctgtggttctggctggaagtgaactctgtagtggatttcttcacg
gtgcccccggtgtttgtgtctgtgtacttaaacagaagctggcttggtttgagattttta
agagctctcagactgatacagttttcagaaatcttgcagtttctgaatatcctgaaaaca
agtaattccatcaagctggtgaatctgctgtccatatttatcagcacgtggctaacagca
gccgggttcatccatttggtggagaattcaggggacccatgggaaaacttccaaaacaac
caggctcttacatactgggagtgtgtctatttactgatggtgaccatgtccaccgtcggc
tacggcgatgtttatgcaaaaaccacacttggccgcctgttcatggtcttcttcatcctc
gggggactggccatgtttgccagctacgtccctgaaatcatagagttaataggaaaccgc
aagaaatacgggggctcctatagtgcggttagtggaagaaagcacattgtggtctgtgga
cacatcactctggagagtgtttccaacttcctgaaggactttctgcacaaggaccgggac
gatgtcaacgtggagattgtctttcttcacaacatttcccctaacctggagcttgaagct
ctgttcaaacggcattttactcaggtggaattttatcagggctcagtcctcaatccacat
gatcttgcgagagtcaagatagagtcagcagatgcgtgcctgatccttgccaataagtac
tgcgctgacccggatgctgaagatgcttccaacatcatgagagtcatctccataaagaac
taccatccgaagatcagaatcatcacccagatgctgcagtatcacaacaaggcccatctg
ctgaatatcccgagctggaattggaaagagggggatgatgcgatctgccttgcagagctg
aagctgggtttcatagcccagagctgcctggctcaaggcctctccacgatgctggccaac
ctcttctccatgaggtcattcataaagattgaggaagacacgtggcagaaatattacttg
gaaggagtctccaatgaaatgtacacagaatatctctccagtgccttcgtgggtctgtcc
ttccctaccgtttgtgagctgtgttttgtgaagctcaagctcctaatgatagccattgag
tacaagtctgccaaccgagagagccgtatattaattaatcctggaaaccaccttaagatc
caagaaggtactttaggatttttcatcgcaagtgatgccaaagaagttaaaagggcgttt
ttttactgcaaggcctgtcacgatgacatcacagatcccaaaagaataaaaaaatgcggc
tgcaaacgtcccaagatgtccatctacaagagaatgagacgggcatgttgttttgattgc
ggacgttctgagcgtgactgctcgtgcatgtcaggccgtgtgcgtggtaacgtggacgcc
ctggggagagccttcccactttcttctgtctctgttaattgctccaccagtttctgtgcc
tttgaagatgaacaaccgtccacgctgtcaccgaaaaaaaagcaacggaatggcggcatg
aggaactcacccagctcctcgcccaagctgatgaggcatgaccctttgttaattcctggc
aatgatcagattgacaacatggactccaatgtgaagaagtatgactctactgggatgttt
cactggtgtgctcccaaggaaatagagaaggtcattctgactcgcagcgaagccgccatg
accgtgctgagtggccacgttgtggtctgcatcttcggcgatgtcagttcagccttgatt
gggctccggaacctggtgatgccgctccgtgccagcaacttccattaccacgagctcaag
cacattgtgtttgtgggctccattgagtacctcaagcgggaatgggagacgcttcacaac
ttccccaaagtgtccatattgcctggtacaccattaagtcgggctgatttaagggccgtc
aacatcaacctctgtgacatgtgcgttatcctgtcagccaatcagaataatattgatgat
acttcgctgcaggacaaggaatgcatcttggcgtcactcaacatcaaatctatgcagttt
gatgacagcattggggtcttgcaggctaattcccaagggttcacacctccaggaatggac
agatcctctccagataacagcccagttcacgggatgttacggcagccatccatcacaact
ggggtcaatatccccatcatcactgaactagtgaatgataccaatgttcagtttttggac
caagacgatgacgatgaccctgacacagaactgtacctcacacagccgtttgcatgtggg
acagcgtttgcagtcagcgtcctggactctctcatgagtgcgacctatttcaatgacaat
atccttaccctgatacggaccctggtgactggaggagccacaccagagctcgaagctctg
attgctgaggagaatgcacttcgagggggctatagcaccccccagacgctggccaacagg
gaccgctgccgtgtggcccagttagccctgctggatggtccctttgctgacttaggggat
ggcggttgttatggtgatctcttctgcaaagctctgaaaacctataatatgctttgtttt
gggatttaccggctgagagatgcacacctcagcacccccagccagtgcacgaagaggtat
gtcatcaccaaccccccatacgaatttgagctcgtgcccacggacctgatcttctgcttg
atgcagtttgaccacaacgccggccagtcccgagccagcctgtcccattcctcccactcg
tcccagtcctctagcaagaagagttcctccgttcactccatcccgtccacagccaaccga
gcgaaccgccccaagtccagggaggcccgggacaaacagaacagaaaagaaatggtttac
agatga

KEGG   Loxodonta africana (African savanna elephant): 100657662
Entry
100657662         CDS       T04351                                 

Gene name
KCNMB3
Definition
(RefSeq) calcium-activated potassium channel subunit beta-3 isoform X3
  KO
K04939  potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100657662 (KCNMB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100657662 (KCNMB3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100657662 (KCNMB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100657662 (KCNMB3)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100657662 (KCNMB3)
SSDB
Motif
Pfam: CaKB tRNA-synt_1g Cyt_bd_oxida_II
Other DBs
NCBI-GeneID: 100657662
NCBI-ProteinID: XP_010594314
LinkDB
Position
Unknown
AA seq 283 aa
MQPFSIPVQITLQGGKRRQGRTGLSTSGKKRNIDYNDGDPPDVHKKLPSSAGEDRAMLLG
FAMMGFSVLMFFLLGITILKPFMLSTQREESNCTITHTRVMDDWLGRAFTRGVDSRSQGK
YPCLQVFVNLAHSGQKALLRYNEEAVQINSKCFYTPKCHRDRNDLLNSALDIKEFFDHKN
GTPFSCFYSPDSQSEDVILIRKYDQVVVFHCLFWPSLTLLGGALIVGMVRLTQHLSLLCE
KYSSAVRDEVGGKIAYIEQHQFQLCSMRGNKGRSRETIRGWPD
NT seq 852 nt   +upstreamnt  +downstreamnt
atgcagccgttcagcatccccgttcaaattacactccagggcggcaagagacgccagggg
agaacaggcctttctacctctgggaaaaagagaaatatagactacaatgatggagaccct
ccagatgtgcacaagaagctgccatccagtgctggagaggatcgagccatgctcctggga
tttgcaatgatgggcttctccgtcctaatgttcttcttgcttggcataaccatcctaaag
cccttcatgctcagtactcagagagaagaatcaaactgcaccatcacccacacacgtgtc
atggacgactggctgggccgtgctttcacccgtggtgtggactcccgaagtcaggggaaa
tacccgtgtctccaggtgttcgtgaacctcgcccactcgggtcagaaagctctcctacgt
tataatgaagaggctgtacagatcaattccaagtgcttttacacacctaagtgtcaccga
gataggaatgatttgctcaacagtgctctggatataaaggaattcttcgatcacaaaaat
gggacccctttttcatgcttctacagtccagacagccaatcggaagatgtcattctcata
agaaagtatgaccaagtggttgtcttccactgtttattttggccttcactgactcttcta
gggggtgccctgattgttggcatggtgagattgacacagcacctgtccttactgtgtgaa
aaatatagcagtgcagtcagagatgaggtaggtggcaaaatagcctacatagaacagcat
caattccagctgtgcagtatgagggggaacaaaggaaggagcagagaaactataagaggg
tggccagattaa

KEGG   Loxodonta africana (African savanna elephant): 100658510
Entry
100658510         CDS       T04351                                 

Gene name
KCNMB2
Definition
(RefSeq) calcium-activated potassium channel subunit beta-2
  KO
K04938  potassium large conductance calcium-activated channel subfamily M beta member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100658510 (KCNMB2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100658510 (KCNMB2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100658510 (KCNMB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100658510 (KCNMB2)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100658510 (KCNMB2)
SSDB
Motif
Pfam: CaKB KcnmB2_inactiv AAA_8 tRNA-synt_1g
Other DBs
NCBI-GeneID: 100658510
NCBI-ProteinID: XP_003416279
UniProt: G3SV70
LinkDB
Position
Unknown
AA seq 235 aa
MFIWTSGRTSSSYRHDEKRNIYQKIKDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
MYFLLGITVLRSYMQSAWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL
TSSGEKFLLYHTEETMKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG
NQKSVILTRLYSSDVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
NT seq 708 nt   +upstreamnt  +downstreamnt
atgtttatatggaccagtggccgaacctcttcatcttacagacatgatgagaaaagaaat
atttaccaaaaaatcaaggaccacgacctcctggacaaaaggaaaacagtcacagcactg
aaagcaggagaggaccgggccattctcctgggactggccatgatggtgtgctccatcatg
atgtactttctgctgggaatcacggtccttcgctcatacatgcagagtgcgtggaccgaa
gagtctcagtgcaccttgctgaatgcatccatcacggaaacgtttaattgctccttcagc
tgtggtccagactgctggaaactctctcagtacccctgcctccaggtatatgtgaacctg
acttcttctggggaaaagttccttctctaccacaccgaagagacaatgaaaatcaatcag
aagtgctcctatatacctaagtgtgggaaaaactttgaagaatccatgtccctggtgaat
gttgtcatggaaaacttcaggaaataccaacacttctcctgctattctgaccctgaaggc
aaccagaagagcgtcatcctaaccagactctacagttccgacgtgctgttccattcactc
ttctggccaacgtgtatgatggctgggggcgtggcgatagtcgccatggtgaaactcaca
cagtatctctccctgctctgtgagaggatccagcggatcaatagataa

KEGG   Loxodonta africana (African savanna elephant): 100663278
Entry
100663278         CDS       T04351                                 

Gene name
KCNMB1
Definition
(RefSeq) calcium-activated potassium channel subunit beta-1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100663278 (KCNMB1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100663278 (KCNMB1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100663278 (KCNMB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100663278 (KCNMB1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100663278 (KCNMB1)
SSDB
Motif
Pfam: CaKB UL41A
Other DBs
NCBI-GeneID: 100663278
NCBI-ProteinID: XP_003404700
LinkDB
Position
Unknown
AA seq 191 aa
MGKKLVMAQKRGETRALCLGVAMVVCAVITYYILGTTVLPLYQKSVWTQESTCHLIETNI
RDQEELEGKKVPQYPCLWVNVSAVGRWAVLYHTEDTRDRNQQCSYIPGSLDNYPVARADV
EKVRAKFHERQVFYCFSTTRENETSVLYQRLYGPQALLFSLFWPTFLLTGGLLIIVMVKI
NQSLSILAAQK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggggaaaaagttggtgatggctcagaagcggggagagactcgagccctttgcctgggt
gtggctatggtggtgtgtgccgtcatcacctactacatcctgggcaccaccgtgctaccc
ctctaccagaaaagtgtgtggacccaggaatccacatgccacctgattgagaccaacatc
agggaccaggaggagctagagggcaagaaggtaccccagtacccgtgcctgtgggtcaac
gtgtcagccgtgggcaggtgggccgtgctgtaccacacggaggacactcgggaccggaac
cagcagtgctcctacatcccaggcagcctggacaactacccagtggcccgggctgatgtg
gaaaaggtcagagccaaattccacgagcgccaggttttctactgcttctcaacaactcgg
gagaacgagaccagtgtcctgtatcagcgcctctatgggccccaggccctccttttctcc
ctcttctggcccaccttcctgctgaccggtggcctcctcattattgtcatggtaaagatc
aaccagtccctctccatcctggcggcccagaagtag

KEGG   Loxodonta africana (African savanna elephant): 100668504
Entry
100668504         CDS       T04351                                 

Gene name
KCNMB4
Definition
(RefSeq) calcium-activated potassium channel subunit beta-4
  KO
K04941  potassium large conductance calcium-activated channel subfamily M beta member 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100668504 (KCNMB4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100668504 (KCNMB4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100668504 (KCNMB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100668504 (KCNMB4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100668504 (KCNMB4)
SSDB
Motif
Pfam: CaKB
Other DBs
NCBI-GeneID: 100668504
NCBI-ProteinID: XP_003405252
UniProt: G3SUY6
LinkDB
Position
Unknown
AA seq 210 aa
MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATAANCTVLSVQ
QIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCE
RENQKNLESVMTWQQYWKEEIGSQPFTCYFNQYQRPDDVLLHRTHDEIVLLHCFLWPLVT
FVVGVLIVVLTICAKSLAVKAEAMKKRKFS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcgaagcttcgggtggcttacgagtacacggaagccgaggacaagagcatccggctc
ggtttgtttctcatcatctccggcgtcgtgtcgctcttcatctttggcttctgctggctc
agtcccgctctgcaggatttgcaagctacggcggccaactgcacggtgctgtcggtgcag
caaatcggcgaggtgttcgagtgcaccttcacctgtggcgccgactgcaggggcacctcg
cagtacccctgcgtccaggtgtacgtaaataactccgagtccaactccagggcgctgctg
cacagcgacgagcaccagctcctgaccaaccccaagtgctcctatatccctccctgtgag
agagaaaatcagaagaacttggaaagtgtcatgacttggcaacagtactggaaggaagag
attggttcccagccatttacttgctattttaatcaatatcaaagaccagatgacgtgctc
ctgcatcgcacgcatgatgagattgtcctcctgcattgcttcctttggcccctggtgaca
tttgtggtgggcgttctcattgtggtcctgaccatctgtgccaagagcctggcagtcaag
gcggaagccatgaagaagcgcaagttctcttaa

KEGG   Loxodonta africana (African savanna elephant): 100675383
Entry
100675383         CDS       T04351                                 

Gene name
KCNU1
Definition
(RefSeq) LOW QUALITY PROTEIN: potassium channel subfamily U member 1
  KO
K05274  potassium large conductance calcium-activated channel subfamily M alpha member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100675383 (KCNU1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100675383 (KCNU1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100675383 (KCNU1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100675383 (KCNU1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100675383 (KCNU1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 100675383
NCBI-ProteinID: XP_023406705
LinkDB
Position
Unknown
AA seq 1154 aa
MPCTREVQVAFILSSCVTFVFGLLILYLSRLICTGFNKYQNSKGRRILLVSFLIWELLIQ
KIFKNKQSRGHSFKGVFRDHIQMLLSAQTSVGRVLVILVFVLSIGSLIIYFINSSDPVGS
CSSYEDKTIPIDLLFNGFFSFYFGLRFLAADDKIKFWLEMNSIVDIFTIPPTFISYYLKS
NWLGLRFLRALRLLELPQILQILQAIKTSNSVKFSKLLSIILSMWFTAAGFIHLVENSGD
PWLKVRNSQNLSYFESIYLVVATTSTVGFGDVVARTSLGRTFIIFFTLASLILFAKYVPE
IVELFANKRKYTNSYEVVKGKKFIVVCGNITVDSVSAFLSNFLRHNLEEISTEIVFLGEN
PPSLELETIFKCYMAYTSFVFGSALKWEDLRRVAVEYAEACLIIANPLCSDSYAEDTSNI
MRVLSIKNYSPKTRVIIQILQSHNKVYLPKIPSWNWKAGDNIICFAELKLGFIAQGCLVP
GLCTFLTSLFVELNTKVTPKQLWQKHFLNGLKHKILTQRLSDDFVEMTFPEVSLICFVKM
NLMLIAIEHKSAMHRYQXGFCGLILNPSAQVKLRKNTIGFFIAESAKEVKRALFYCSTCH
SDVNNPELIGKCGCKTKSHRHNIRGNCTLCLAVHSPASRHLGQGKRRGFYLLKDNGSLNL
AKKRAGISPLGTTFLYEKDEKTDRLDSSGMFHWCKAISLDKVILKRSDKRKHDFRNHVVA
CVFGDAHSALMGLRNFVMPLRASNYAPKELKDIVFIGSLDYLQREWRFLRNFPQIYILPG
SALFSGDLHAANIEECSMCAVLSPPYKPSSSQTLVDTEAIMTTLNVGSLRISCSAQTPSV
TECFPQDSTEARKTSKYRRIPILTELKNPSNVRFIEQLGGMKGSLPGTNLHLSTSFSTGA
VFSGSFLDSLLATAFYNYRVLELLQMLVTGGISSQLEQQLDKDKQYEPSDSCATFFSARA
RCKLELLSLNKTILSEIQPRDYFGQVFCGSLNNFGILCLGLYRMIDEEDRNPEHKRGVCX
FVITRPAKDLKLLPSDLVFCAIPFSTSFYDKDAVSSRQRYETVNLEPLTQENILDSNEPP
VINPVNMNAPCYRHLSEPPVDPAMDNFSIPNQTMLYQSDKLSSQIHLGENGKGNVRENIK
DIIQEDVSEPPVPN
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgccctgtacaagggaggtccaagtagcatttattctctcctcctgtgtgaccttcgtc
ttcggactcctcatcttatacctttccaggctaatctgtacgggctttaataaatatcaa
aacagcaagggaagaagaattctattggtcagtttccttatttgggaactactcatccaa
aaaatcttcaaaaataaacagtcaagaggacactccttcaaaggagtctttcgtgatcat
atacaaatgttgctttcggcacagacttccgtggggcgagtgctagttatccttgtcttt
gtactaagtatcggatctcttataatctatttcatcaactcttctgaccctgttggaagt
tgttcttcatatgaagacaaaaccattcctattgatttgcttttcaatggtttctttagc
ttctattttgggctgagatttttggcagctgatgacaagatcaagttctggttggagatg
aattcgattgtagacatctttaccatcccaccaaccttcatttcttattatttgaagagt
aattggctgggtttaaggttcctaagagcactgaggctgctagaactcccacaaatcttg
caaattctacaggccatcaagaccagtaactccgtgaagttttccaaactgttatccata
attcttagtatgtggttcactgctgcaggattcattcacctggtggaaaattctggtgat
ccttggctcaaagttagaaattcacagaatttatcttactttgaatcaatttacctagtc
gtggcaacaacatcaactgttggctttggagatgtggtagcccggacatccctgggacgg
accttcatcatcttcttcacccttgcgagtttgatactgtttgcaaaatacgtccctgaa
attgtggaactttttgctaacaagaggaaatacaccaattcctatgaagtggtcaaaggg
aagaagttcattgtggtttgtggaaacatcactgtcgacagtgtgagtgcttttctgagc
aatttcctccgccataatttggaagaaatcagcacggaaatcgtttttctgggagagaac
cctccttctttggaactggaaaccatatttaagtgctacatggcctatacaagttttgtt
tttggatctgcacttaagtgggaggatctgaggcgggttgcggtggaatatgcagaagca
tgcctgattatagccaaccctttgtgcagtgattcgtatgctgaagacacttcaaacatc
atgagggtgctctctatcaagaactattcccctaagaccagagtcatcatacagatactt
caatcccataacaaggtttacctgccaaagatccccagctggaactggaaagctggggac
aacatcatctgctttgctgaactgaagcttggatttattgcccaaggctgcctggtgcca
ggcttgtgcaccttcctaacctctctatttgttgagctcaacacaaaggtgactcctaaa
cagctctggcaaaaacatttcttaaatggtttgaagcacaaaatcctgactcaacgtctc
tctgatgactttgtagaaatgacttttcctgaagtttcactaatctgctttgtgaagatg
aacctcatgctgattgccatcgaacacaagtctgccatgcacaggtatcaatgaggcttc
tgtggtctgatactaaatccatctgcgcaagttaagcttcgtaagaacacaatagggttc
tttattgctgaatctgcaaaggaagtcaagagagccttattttactgttccacctgtcac
agtgatgtgaataatcctgagctaattggaaaatgtggctgcaaaaccaagagccatcga
cataacatcagaggtaactgcactttatgtctagctgtccatagcccagcttctaggcac
ctgggccaaggcaagagaaggggattctatctcctaaaagacaatggctctttgaacttg
gcaaaaaaaagagcaggcatttctccactgggcacgacttttctatatgaaaaggacgaa
aaaactgaccgactggatagcagtggcatgtttcactggtgcaaagcaatctctttggac
aaagtgattctgaaacgatctgacaagagaaaacatgattttcgaaaccacgttgtagca
tgtgtctttggagatgcccactcagctctgatggggcttcggaattttgtaatgcccttg
agagctagcaactatgccccgaaggagctgaaggacattgtgttcattgggtccctggat
tacctacagagagaatggcgatttctccggaattttccccagatatatattttgcctgga
tctgcactcttttctggagacctccatgcggccaatatagaggaatgttccatgtgcgct
gtcttgtccccaccatacaagccttcaagcagccagactctggtggacacagaggccatc
atgaccaccctcaacgttgggtccctgcggattagctgctctgcccagacaccctcagtg
acagagtgttttccacaggactcaactgaagctcgtaagacttcaaaataccgaagaatc
cctatcctaaccgaattgaaaaacccttccaacgttcgctttattgaacagcttggtgga
atgaaaggaagccttccaggaacaaacctgcatctcagcacttccttttccacaggcgct
gtcttttcaggtagcttcttggattccctcttggccacggccttctacaactatcgtgtc
ctggaattacttcagatgctggtgacaggaggaataagttctcagctagaacaacagttg
gataaggataagcagtatgaaccgtctgacagctgtgctacattcttttctgcaagagct
cggtgtaagctggaacttctctccttgaacaaaaccattttatcagagattcaaccaaga
gactactttgggcaagtgttctgtggctcattaaataatttcggaatcctgtgccttggc
ttataccgcatgatagatgaagaggaccgcaacccagaacacaaaaggggagtatgctag
tttgtgattacccggccagccaaagatctgaaactgctgccctcagatctcgtcttttgt
gccatccctttcagcacctccttttatgacaaagatgctgtttcatctcgacaacgatat
gaaactgtaaatctagagccactgacacaagaaaacattctagactcaaacgaacctcca
gtgattaacccagttaacatgaatgcaccatgctaccggcacttatcagagccgcctgtg
gatccagccatggacaacttttctatacctaaccaaacaatgttatatcagagtgataag
ctgtcatcccagatacatctaggtgaaaatgggaaaggaaatgtaagggaaaacataaag
gacataatacaggaggatgtctctgaacctccagtgccaaactag

DBGET integrated database retrieval system