KEGG   Loxodonta africana (African savanna elephant): 100656270
Entry
100656270         CDS       T04351                                 

Gene name
PDE3A
Definition
(RefSeq) cGMP-inhibited 3',5'-cyclic phosphodiesterase A
  KO
K19021  cGMP-inhibited 3',5'-cyclic phosphodiesterase A [EC:3.1.4.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04924  Renin secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100656270 (PDE3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100656270 (PDE3A)
   04022 cGMP-PKG signaling pathway
    100656270 (PDE3A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100656270 (PDE3A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100656270 (PDE3A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100656270 (PDE3A)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 100656270
NCBI-ProteinID: XP_003405726
LinkDB
Position
Unknown
AA seq 1141 aa
MAVPGEAARVRDKPSHGGAIPAPAAGPDCHGRAGPASPLDSGCCGCWGDLVLQPLRRSRK
LSSALCAGSLSFLLALLVRLVRGEIGCDLEQSSEEAAVEEAARGAGGGVFPGPRGGAPGG
GAPLSPWLQPSALLFSLLCAFFWMGLYLLRAGVSLPLAVALLAACCGGEALVQIGLGVGE
DHLLSLPAAGVVLSCLAAATWLVLKLRLGVLMIALTSAVRTVSLISLERFKVAWRPYLAY
LAGVLGILLARYVEQILPQSAGATPREHFGSQLIAGTKEDIPVFKRRRRSSSVVSAEMSG
CSSKSHRRTSLPCIPREQLMGHSEWDHKRGQRGSQSSGTSITVDIAVMGEAHGLITDLLA
DPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVISFSENYTCSDSEESSEKDKLAIP
KRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSASIKLHEAPLSSAVNPDSW
NNPVMMTLTKSRSFTSSYTVSAANHVKAKKQNRPDALAKISPLSSPCSSPIQGTPASSPI
SKTSAVQFPESAETTAKQGLSSHRALTYYTQSAPDLAPQILTTPVICSSCGRAYSHGNPA
DGPLERGRTTLRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECSRESLRKVSACST
YTPETMIFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLMEKIGRKCGCILSQVSYRL
FEDMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTV
INDHGSTSDSDSDSGFTHGHMGYVFSKMYGVPDDKYGCLSGNIPALELMALYVAAAMHDY
DHPGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLVNLDHVEFKHFR
FLVIEAILATDLKKHFDFVAKFNAKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCK
ELHLQWTEGIVNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDS
AGLMPGKWVEDSDESGDTDDPEEEEGEAPTEEETCENNESPRKKTFKRRKIYCQITQHLL
QNHKMWKKVIEEEQRLAGMEKQSLDQCPQPHSSELIQAIREEEEEKGKQRAEEIPTPKPN
Q
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggcagtgcctggcgaggccgcccgagtcagggacaagcccagccacggtggggcgatt
ccagcccccgcggccggcccagactgccacggtcgtgcgggccccgcgtcgccgctggac
tcgggctgctgcggctgctggggagacctggtgctgcagccgctccggcgctccaggaaa
ctttcctccgctctgtgcgcgggctccctgtcctttctcttggcgctcctggtgaggctg
gtccgcggggagatcggctgtgacctggagcagagtagtgaggaggcggccgtggaggaa
gcggcccggggagcaggagggggcgtcttcccagggcctcggggaggtgctcccgggggc
ggcgcgccgctcagcccctggctgcagccctcggcgctgctcttcagtctcctgtgtgcc
ttcttctggatgggcttgtacctcctgcgcgctggggtaagcctgcctctggccgtggcg
ctgctggccgcctgctgcgggggagaagcgctcgtccagattgggctgggcgtcggggag
gatcacttactctcgctccccgccgcgggggtggtgctcagctgtttggccgccgcgaca
tggctggtgctgaagctgaggctgggcgtcctcatgatcgccttgactagcgcggtcagg
accgtgtctctcatttccttagagaggttcaaggtcgcctggagaccttacctggcgtac
ttggcaggcgtactggggatcctcctggccaggtacgtggagcaaatcttgccgcagtct
gcgggggcgactccgagggaacattttgggtcccagctgattgctgggaccaaggaagat
atcccggtgtttaagaggaggaggcggtccagctccgtggtgtccgccgagatgtcgggc
tgcagcagcaagtcgcataggaggacctccctaccttgcataccgagagaacagctcatg
gggcattcggaatgggaccataagcgagggcaaagaggatcccagtcttcaggaaccagt
attactgtggatattgccgtgatgggcgaggctcacggtctcattaccgaccttctagca
gacccttctctgcccccaaacgtgtgcacatccttgagggcagtgagcaacctacttagc
acacagctcaccttccaggccattcacaagcccagagtgaaccccgtcatttccttcagt
gagaactatacctgttccgattctgaagaaagttctgaaaaagacaagctggctattccc
aagcgcctgagaaggagtttgcccccaggattgttgagacgagtttcatctacttggaca
accaccacctcagccacaggtctacccaccttagaacctgcaccagttcgaagggaccgt
agcgccagcatcaaactgcatgaagcacctttatccagtgcggtgaatcctgattcttgg
aataacccagtgatgatgaccctcaccaaaagcagatccttcacgtcttcctatactgtt
tctgcagctaatcatgtaaaggctaaaaagcaaaatcgaccagatgccctagcaaagatt
tcacctctctcatcgccctgttcctcacctatccaagggactcctgccagcagcccgatc
agcaaaacttctgcagtgcagttccctgaatctgcagaaacaactgctaaacaaggccta
agttctcacagggctttaacttactatactcagagtgcccctgacctagcccctcagatc
ctgactacaccagttatatgtagcagctgtggcagagcatattcccatgggaatccagct
gatgggccactggagagaggcagaacgacccttcggacaccaagcagaacggatgacaca
gctcaagttacctctgactatgaaaccaataacaacagtgacagcagtgatattgtacag
aatgaagatgagactgagtgttccagagagtcactgaggaaagtgtcagcttgcagcacc
tacaccccggagaccatgatatttctggacaaaccaattcttgctcctgaacctcttgtc
atggataacctggactcaattatggaacagctaaatacttggaattttccaatttttgat
ttgatggaaaagataggaagaaaatgtggctgtattcttagtcaggtatcatacagactt
tttgaagacatgggtctgtttgaagcttttaaaattccaattagggaatttatgaattac
tttcatgctttggagattggctatagggatattccctaccataacagaatccatgccact
gacgtcttacatgcagtttggtatcttactacacaacctattccaggactctccactgtg
attaatgatcatgggtcaacaagtgattcagattctgacagtggatttacacatggacat
atgggatatgtattctcaaaaatgtatggtgtgccagatgataaatatggatgtctgtct
gggaatatccctgccttagagttgatggcactgtatgtggctgctgccatgcatgattac
gatcatccaggaaggactaatgcctttctggttgcaactagtgctcctcaggcggtgcta
tacaacgaccgttcagttttggagaatcaccatgcagctgctgcgtggaatcttttcatg
tcccggccagagtataacttcttagttaaccttgaccatgtggaatttaagcatttccgt
ttccttgtcattgaagcgattttggccacagacctgaagaaacactttgacttcgttgcc
aaatttaatgccaaggtaaatgacgatgttggaatagattggaccaatgaaaatgatcgt
ctcctggtttgtcaaatgtgtataaagttggctgatatcaatggaccagctaaatgtaag
gaactccatcttcagtggacagagggcattgtcaatgaattttatgagcagggtgatgaa
gaggccagtcttgggctaccaataagccccttcatggaccgctctgctcctcagttggcc
aatcttcaggaatccttcatctctcacattgtgggtcctctgtgcaactcctatgactca
gcaggtctcatgccagggaagtgggtggaagacagtgatgagtcaggagatactgatgac
ccagaggaagaagaaggggaagcaccaactgaagaggaaacctgtgaaaataatgaatct
ccaagaaagaaaactttcaaaaggaggaaaatctactgccaaataactcagcacctcctg
cagaaccacaagatgtggaagaaggtcatagaagaggaacagcggttggcaggcatggaa
aagcaatccctggaccagtgccctcagccgcactcctcagaactgatccaggccatcagg
gaagaagaggaagagaaaggaaagcagagagcagaggagatcccaaccccaaagccaaac
cagtga

KEGG   Loxodonta africana (African savanna elephant): 100656573
Entry
100656573         CDS       T04351                                 

Gene name
PDE4D
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4D isoform X2
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04024  cAMP signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100656573 (PDE4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100656573 (PDE4D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100656573 (PDE4D)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100656573 (PDE4D)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100656573 (PDE4D)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 100656573
NCBI-ProteinID: XP_010586455
LinkDB
Position
Unknown
AA seq 688 aa
MAFVWDPLGATAPGPSPRAKTRLRFAKSYSFDVDNGTSSGRSPLDPMTSPGSGLILQANF
VHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFAA
LTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSVSE
MASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQHEVEIPSPTQKEKEKKKRPMS
QISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTV
IMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPA
LEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKL
LQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLL
DNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDK
HNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDD
QEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDE
QVEEEAVGEEEESQPEACVIEDHSSDDT
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggctttcgtttgggatcctttgggagccacagcgccaggaccatctccaagagccaaa
acaagattgcgttttgcaaagtcctacagtttcgatgtggacaatggcacatcttcggga
cggagtcccttggatcccatgaccagcccaggatctgggctaattctccaagcaaacttt
gtccacagtcaacgtcgggagtccttcctgtatcgatccgacagcgattatgacctctct
ccaaagtctatgtcccggaactcctccattgccagtgatatacatggagatgacttgatt
gtgaccccatttgctcaggtcttggccagcctgcgaactgtacgaaacaactttgctgca
ttaactaatttgcaagatcgagcacctagcaaaagatcacccatgtgcaaccaaccatcc
atcaacaaagccaccatcacagaggaggcctaccaaaaactggccagcgagaccctggag
gagctggactggtgtctggaccagctagagaccctgcagaccaggcactctgtcagtgaa
atggcctccaacaagtttaaaaggatgcttaatcgggagctcacccatctctctgaaatg
agtcggtctggaaatcaagtatcagaatatatatcaaacacatttttagataagcaacat
gaggtggaaattccttctccaactcagaaggaaaaggagaaaaagaaaaggccaatgtct
cagatcagtggagtcaagaagttgatgcacagctctagtttgactaattcgagtatcccg
aggtttggagttaaaactgaacaagaagatgtccttgccaaggaactagaagatgtgaac
aaatggggtcttcatgttttcagaatagcagagttgtctggtaaccggcctttgactgtt
atcatgcacaccatttttcaggaacgggatttgttaaaaacatttaaaattccagtagat
actttaattacataccttatgactcttgaagaccattaccatgctgatgtggcctatcac
aacaatatccacgcggcagacgtggtccagtccactcatgtgctattatcaacacctgct
ttggaggctgtgtttacagatttggaaattcttgcagcaatttttgccagtgcgatacat
gatgtggatcatcctggggtctccaatcagtttctgatcaatacaaactctgaacttgcc
ttgatgtacaatgattcctctgtcttggagaaccaccatttggccgtgggctttaagttg
ctccaggaagaaaactgtgacattttccagaatttgaccaaaaagcaaagacaatcatta
aggaaaatggtcattgacattgtacttgcgacagacatgtcaaaacacatgaatctactg
gctgacctgaaaactatggttgaaactaagaaagtgacaagctctggggttcttcttctt
gacaattattctgacaggattcaggtccttcagaatatggtgcattgtgcggatctgagc
aacccgacaaagccgctgcagctgtaccgccagtggacggaccggataatggaggagttt
ttccgccaaggggaccgtgagagggagcgcggcatggagatcagccccatgtgtgacaag
cacaacgcctctgtggaaaaatcacaggtgggcttcatagactatattgttcatcctctc
tgggagacctgggcagaccttgtccatcctgatgcccaggacattttggacactttggag
gacaatcgtgaatggtaccagagcacaatccctcagagtccctcacctgcccctgatgac
caagaagagggccgacagggtcagaccgagaaattccagtttgaactaactctagaggaa
gatggcgaatcagacacagagaaggatagtggaagtcaagtggaggaagacactagctgc
agtgactccaagactctctgtactcaagactcagagtccaccgaaatcccccttgatgaa
caggtcgaagaggaagcagtaggggaagaagaggaaagccagcccgaagcttgtgtaata
gaagatcattcttctgacgacacgtaa

KEGG   Loxodonta africana (African savanna elephant): 100658501
Entry
100658501         CDS       T04351                                 

Gene name
PDE8A
Definition
(RefSeq) high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A isoform X3
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100658501 (PDE8A)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100658501 (PDE8A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100658501 (PDE8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100658501 (PDE8A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100658501 (PDE8A)
SSDB
Motif
Pfam: PDEase_I PAS_9 PAS PAS_3 PAS_4 UBA_e1_thiolCys
Other DBs
NCBI-GeneID: 100658501
NCBI-ProteinID: XP_010592101
LinkDB
Position
Unknown
AA seq 687 aa
MRFHQDQLQVLLVFTKEDSQCNGFYKACEKTGFKCTVTKEPQAVLACFLDKHHDIIIIDH
RHPRQLDADALCRSIRSSKLSENTVIIGVVRRGDREESSVMPLVAAGFTRRYVENPSVMA
CYNELIQLEYGEVRSQLKLRACNSVFTALEKSQEAIEITSEDHIIQYANPAFETTMGYQS
GELIGKELAEVPINEKKADLLNTINSYIRIGKEWQGIYCTKKKNGDNIQQNVKIIPVIGQ
GGKIRHYVSIIRVCNGNNKAEKIAECVQPDSLTDVQTGKLIKDRRKDSLDVRSLSTRSSE
VASQRRHSSLARIHSMTIDAPITKVINIINAAQESSPVPVTEALDRVLEILRTTELYSPQ
FGAKDDDPHANDLVGGLMCDGLRRLSGNDYVLSPKNLHQVSSRIINSISLHDIPPRIARI
MENEEFWDFDIFELEAATHKRPLIYLGLKIFARFGICEFLNCSESTLKSWLQVIETNYHS
SNPYHNSTHAADVLHATAYFLSKERIKQTLDPVDEVAALLAATIHDVDHPGRTNSFLCNA
GSELAILYNDTAVLESHHAALGFQLTIRDDKCNIFKNMERNDYRMLRQGIIDMVLATEMT
KHFEHVNKFVNSINKPLALLEENRETDKDQEAVNTMLRTPENRTLIKRMLIKCADVSNPC
RSLEFCIEWAARISEEYFSQPLLTCRI
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgagatttcatcaagatcaacttcaggtacttttagtgtttaccaaagaagatagccag
tgtaacggattctataaggcatgtgaaaagacagggtttaagtgtacagtcaccaaggag
cctcaggcagtgcttgcctgcttcctggacaaacaccatgacatcatcatcatagaccac
agacatccccgccagctggatgcagatgcactgtgcaggtctatcagatcgtcaaaactc
tcagagaacacagttattattggtgttgtacgcaggggggatagagaagagtcatctgta
atgcccctcgttgctgctggttttacaaggaggtatgtagaaaaccccagtgtcatggcc
tgttacaatgagctgatccagctggagtatggagaagtgcgatcccaactgaaactcagg
gcttgtaactcagtattcactgcactagagaaaagtcaagaagcaattgaaattacaagt
gaagaccacattatacagtatgcaaatcctgcatttgaaacaacaatgggctatcagtca
ggtgaattaatagggaaggagttagctgaagtgcctataaatgaaaaaaaggctgacttg
ctcaatactataaattcatatatcaggattggcaaggagtggcaaggaatttattgcacc
aaaaagaaaaacggagataatattcaacaaaatgtgaagataatacctgtcattggacag
ggaggaaaaattagacactatgtgtccattatcagagtgtgcaatggcaacaataaggct
gagaaaatagctgaatgtgttcagcctgacagtcttacagatgtgcagacaggcaaactt
attaaagacaggagaaaagactcgctagatgtcagatctctttccactcgatcaagtgaa
gttgccagccagagacgacactcctccttggcccggatacattccatgacgatcgatgca
cccatcaccaaggtaatcaatattatcaatgctgcccaagaaagcagtcccgtgcctgtg
acagaagccttagaccgtgtgctggaaattttaagaaccactgaattatattcaccacag
tttggtgctaaggacgacgatcctcatgccaacgacctggttgggggcttaatgtgtgat
ggtttgcgaagactatcagggaatgactatgttctttcaccaaagaaccttcaccaggtt
tcaagcagaataatcaattccatctcccttcatgacattccaccacggatagctcgaatc
atggaaaatgaggaattctgggactttgatatttttgaactggaggctgccacccacaag
aggcctttgatttatcttggtctcaaaatatttgctcgatttggaatctgtgagttctta
aactgctctgagtcaacgctcaagtcgtggttacaagttatcgaaaccaattatcattct
tctaacccttaccacaactctacacatgctgctgatgtgctgcacgcaacagcgtatttc
ctgtccaaagaaaggataaagcaaactttagatccagttgacgaggtcgctgcccttctt
gcagccactattcacgacgtggatcatcctgggagaaccaactctttcttgtgtaatgct
ggaagcgagctggccattttgtacaatgacactgctgtcctggagagccaccatgcagcc
ctgggcttccagctgaccatccgggatgataaatgcaatatttttaaaaacatggagagg
aatgactatcggatgctgcgccagggtattattgacatggtcctagctacagaaatgaca
aagcacttcgagcacgtcaacaagtttgtcaacagtatcaacaagcccttggcattacta
gaagaaaacagggaaactgataaagatcaggaagcagtaaacactatgctcaggacacca
gagaaccgaactctgatcaaacgaatgctgattaagtgtgctgatgtgtccaatccctgt
cgatccctggagttctgcatcgagtgggctgcacgtatctctgaagaatatttttctcag
cctttgttgacctgccggatttaa

KEGG   Loxodonta africana (African savanna elephant): 100660871
Entry
100660871         CDS       T04351                                 

Gene name
PDE3B
Definition
(RefSeq) LOW QUALITY PROTEIN: cGMP-inhibited 3',5'-cyclic phosphodiesterase B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04371  Apelin signaling pathway
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04922  Glucagon signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100660871 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100660871 (PDE3B)
   04024 cAMP signaling pathway
    100660871 (PDE3B)
   04022 cGMP-PKG signaling pathway
    100660871 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100660871 (PDE3B)
   04922 Glucagon signaling pathway
    100660871 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    100660871 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    100660871 (PDE3B)
   04924 Renin secretion
    100660871 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100660871 (PDE3B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100660871 (PDE3B)
SSDB
Motif
Pfam: PDEase_I DUF1129
Other DBs
NCBI-GeneID: 100660871
NCBI-ProteinID: XP_023406694
LinkDB
Position
Unknown
AA seq 1130 aa
HEEGRRDAKHAVPQPPDGAGSPPESLRNGYVRAAXAPCGQDPPRGFFFHLCRFCNVELLL
PPSASPQQXRRGSPFSRARLSLGALAAFVLALLLGSGPGSWAAGAALLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRFGGGGGSWWLLALPACCYLGDFLAWQWWSSSWG
DGGAEVPEPPHTPPAPHTPPAALGRLFLVLSCVGLLTLLHPVRLQHSILVLLFSSFVWWV
SFTSLGSLPAPLRPLLSCLVGSAGCLLAQGLDHFFQIREAPHHHPRLSSTAEEKVPVIRP
RRRSSCVSLGETSASYYGSCKMFRRPSLPCISREQMILWDWDLKQWYKLHYQNSGGGNGI
DLSVLNEARNMVSDLLTDPTLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCS
EMEDPAEKGDRKLHKGVNSRSSLPTPQLRRSSGTSGLPPIEQSSSRWERNNGKRPHQEFG
ISSQGCYLNGPFSSNLLTIPKQRSSSVSFTHHINLRRAGALSSVSPVTSPTHGPVSAGSL
TNRSPIEFPDTADFLTKPSVILHKSVGNVPNTPDSYQQLRNSDNNLCNSCGHQILKYVAT
PESESGTDCHSGKSGEEKNTIFSKESFKLTDTQEEKTEKIDCKQLFLEGDNQRREEARNE
QQPNMEQESSLDLILIEDHDSLIEKMSNWNFQIFELVEKMGEKSGRILSQVMYTLFQDTG
LLEIFKIPTQQFMNYFHALENGYRDIPYHNRIHATDVLHAVWYLTTRPIPGFQQTHNDHG
TANEADSDGRINPARIAYISSKSCSIPDESYGCLSSNIPALELMALYVAAAMHDYDHPGR
TNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLNLDHVEFKRFRFLVIE
IILATDLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCMKLADINGPAKVRDLH
LKWTEGIVNEFYEQGDEEANLGLPVSPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGL
LPGQWIETEEDDDIESDDEEEDAEELDTDDEEMEDTLNPKPQRRKGRRRIFCQLMHHLTE
NHKIWKEIIEEEEKCKADGNKLQVDNSSLPQADEIQVIEEADEEEERQFE
NT seq 3393 nt   +upstreamnt  +downstreamnt
catgaggagggacgacgagacgccaagcatgcggtaccgcagcctccggacggggccggc
tcgccccctgagagtctgaggaacggctacgtgagagctgcgtgagccccttgcgggcag
gaccctccccgcggcttcttcttccacctttgccgcttctgcaacgtggagttgttgctg
ccaccgtcggcctccccccagcagncgcggcgcggctcccccttctcccgggcgcgcctc
tcgttgggcgccctggctgcctttgtcctcgccctgctgctcggctcggggcccgggagc
tgggctgcgggggccgccctgctgcggaccttgctgagcgtctgctcgcacagcctcagc
cccctcttcagcatcgcctgtgccttcttcttcctcacctgcttcctgacccggaccaag
cggggccccgggccgggccggttcggcggcggtggcggctcctggtggctgctggcgctg
ccagcttgctgttacctgggggacttcttggcgtggcagtggtggtcttcgtcgtgggga
gacggaggcgcggaggtccccgagcctccgcacacgcccccggccccgcacacgccccca
gccgccttgggcaggttgttcttggtgctgagctgtgtgggtttgctgacgctcctgcac
ccggtgaggctccagcacagcatcctggtactgctcttctccagctttgtctggtgggtc
tccttcaccagcctcgggtcgctgcctgcacccctcaggcccctgctgtcctgcctggtg
gggagcgctggctgcctgctggcccaggggttggatcacttctttcaaatcagggaagct
cctcatcatcatcctcggttgtccagtaccgcggaagaaaaagtgcctgtgatcagaccc
cggaggaggtccagctgcgtgtcgctaggagagacttcagccagttactatgggagttgc
aaaatgttcaggagaccttcgttgccttgtatatccagagaacagatgattctttgggat
tgggatttaaagcagtggtataaacttcattatcagaattctggaggtggaaatggaatt
gatctttcagtgttaaacgaagctcgtaacatggtgtcagacctcctgactgatccaacc
cttcccccacaagtcatttcttccctacggagtatcagtagcttgatgggtgctttctca
ggttcctgtaggccaaagattaatcctctgacaccgtttcctggattttacccctgctct
gaaatggaggacccagctgagaaaggagatcgaaagcttcacaagggagtaaacagtagg
agtagtttaccaacaccacagctgaggaggagttcaggaacttccggtctgccacccatt
gaacagtcttcttcaaggtgggaacgtaataatggcaaaagacctcatcaagaatttggc
atttcaagtcaaggatgctatctaaatggaccatttagttcaaatctactgacaattccg
aagcaaaggtcttcttctgtatcatttactcaccatataaatctgagaagagctggtgct
ttatccagtgtgagtcctgtgacttctcccacccatggaccagtgtctgctggttctcta
actaatcggtcacctatagaatttcctgacactgctgattttcttactaagccaagtgtt
attttacacaaatctgtgggcaatgtacccaataccccagattcttatcagcagcttaga
aattctgataacaatctttgtaacagctgtggacatcaaatactgaaatacgttgcaaca
cctgaatcagaatctggtacagactgccacagtggaaaatcaggtgaagaaaaaaatacc
attttctcaaaagaatcattcaaacttacagatactcaagaagagaaaacagagaagata
gactgcaaacagttattcctggaaggtgataatcaacgaagagaagaggcacggaatgaa
caacaaccaaatatggaacaagaatcatcactggacttgattttaatagaagatcatgac
tcattaatagaaaagatgagcaactggaattttcaaatttttgaacttgtagaaaagatg
ggagagaaatcaggaaggattctcagtcaggttatgtataccttatttcaagacactggc
ttgttggaaatatttaaaattcccactcaacaattcatgaactattttcatgcattagaa
aatggctatcgagacattccttatcacaatcgtatacatgccacagatgtcttacatgca
gtttggtatctgacaacgcggccaattcctggttttcagcagactcacaatgatcatgga
accgcaaatgaagcagattctgatgggagaatcaatcctgcacgaattgcttatatttct
tcaaagagctgctctattccggatgagagctatggctgcctgtcttcaaatattcctgcg
ttggaattgatggctctgtatgtggcagctgccatgcacgattatgatcaccccgggcgg
acaaatgcatttctagtggctacaaatgcccctcaggcagttttgtacaatgacagatct
gttcttgaaaatcatcatgctgcatcagcttggaatttatatctttctcgcccagagtac
aactttcttcttaatctcgatcatgtagaattcaagcgctttcgttttttagtcattgaa
ataatccttgccacagatcttaaaaagcattttgatttccttgctgaattcaatgccaag
gccaatgatgtaaatagtaatggtatagaatggagtaatgaaaatgatcgcctcttagtg
tgccaagtatgcatgaaactagcagatataaatggcccagcaaaagttcgggacttgcat
ttgaaatggacagaaggcattgtgaatgaattttatgagcagggagatgaagaagcaaat
cttggtctgcctgtcagtccgttcatggatcgctcctctcctcaactagcaaaactccaa
gaatcttttatcacccacatagtgggccccctgtgtaactcctatgatgctgctggttta
ctacctggccagtggattgaaacagaagaggatgacgatattgaaagtgatgatgaggaa
gaagatgctgaagaattagatacagatgatgaagaaatggaagacactctaaatcctaaa
ccacaaagaaggaaaggcagacggcgaatattttgtcaactaatgcaccacctcaccgaa
aaccataagatatggaaagaaatcatagaggaagaagaaaaatgtaaagctgatgggaat
aaactgcaggtggacaattcttccttacctcaagcagatgagattcaggtcattgaagaa
gcagatgaagaggaagagcgacagtttgaataa

KEGG   Loxodonta africana (African savanna elephant): 100664597
Entry
100664597         CDS       T04351                                 

Gene name
PDE2A
Definition
(RefSeq) cGMP-dependent 3',5'-cyclic phosphodiesterase
  KO
K18283  cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04740  Olfactory transduction
lav04925  Aldosterone synthesis and secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100664597 (PDE2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100664597 (PDE2A)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100664597 (PDE2A)
  09157 Sensory system
   04740 Olfactory transduction
    100664597 (PDE2A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100664597 (PDE2A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100664597 (PDE2A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3
Other DBs
NCBI-GeneID: 100664597
NCBI-ProteinID: XP_023394813
LinkDB
Position
Unknown
AA seq 1190 aa
MGQACGHSILCRSQQYPAARPAEPLVILAMERAQTALALIFVGDRHTQAQAMNLVGPVAG
TAEGGDPQGTGTCGTTRYPAAATLQVSTHLVQLLSPTVTEENHRFQQSRAGVQLVPGRNL
PSSVPAPLKPLPLAPPPSAPQIRELAGTPLHRRQHPQGVKTINWSVTEPMWNCVYVTVWG
DTVDPRSMGCDTEGEGHPGESDRGGITVCDPVVTPTHSLMPIQEPPELHPPPVFSGEHGK
EEVETSIQWTCEGQDQGAESSSRGKGTRAGLGFWEDRTRAGLGDRVATWRVGEEWAGETG
AGGNRECGRVRDGEREEMPSERKREDAEVGKDAEPHGDETREPLVTERWKLAVADALLSL
GSVIDIAGLQQAVKEALSAVLPRVETVYTYLLDGESRLVCEDPPHELLQEGKVREAVISQ
KRLGCNGLGPSDLPGKPLARLVAPLAPGTQVLVIPLVDKEAGAVAGVILVHCGQLSDSEE
WSLQLYDLDASSLQLKVLQYLQQETGASRCCLLLVSEDNLQLSCKVIGEKVLEEEISFPL
TMGRLGQVVEDKKSIQLKDLTSEDVQQLQNVLGCGLQAMLCVPVISRATDQVVALACAFN
KLGGDLFTEQDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVS
VLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVAT
TGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSK
FDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLYNGIQ
PVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYR
DPPYHNWMHAFSVSHFCYLLYKNLELANYLEDIEIFALFISCMCHDLDHRGTNNSFQVAS
KSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLA
HHLRIFKDLQKMAEVGYDRTNKQHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFF
SQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASN
REHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPKMDGAGGPVNGCCSLDAE
NT seq 3573 nt   +upstreamnt  +downstreamnt
atggggcaggcgtgcggccactccatcctctgcaggagccagcagtacccggcagcgcga
ccggctgagccgcttgtcatcctggccatggagagggctcagacagcccttgccctcatc
tttgttggagacaggcacacccaggcccaggcaatgaacctggtggggccagttgcaggc
acggctgagggaggagatccccagggcacaggaacatgtggcacaaccagataccctgcc
gcagccaccctacaagtgtccacacacctggtgcagctcctgtcacctaccgtcactgag
gagaaccacagattccagcagtcacgggcaggcgtccagctcgtgccaggccgcaacctc
ccttcatccgttcctgcccccctaaaacccctcccactggctcctcccccctcagctcct
caaatccgagaactggctgggacccccttgcacaggagacagcacccccagggagtaaag
acaatcaactggagtgtgacagagccaatgtggaactgtgtgtatgtcaccgtgtggggt
gacactgtggacccccggagcatggggtgtgacaccgagggtgagggccatcctggtgag
agtgaccggggtggtatcactgtgtgtgaccctgtggtgacccccacccactccctcatg
cccattcaggagccaccagagctacacccacccccagtcttcagtggggaacacgggaag
gaggaggtggagacgagcatccagtggacatgcgaagggcaagaccagggagcagaatcc
agcagccggggcaagggcacgagagcaggcctgggcttctgggaggaccggaccagggct
gggttgggggacagggtggctacttggagggttggggaggagtgggcaggagagacagga
gcgggtgggaacagggagtgtgggagagtgagagatggcgagcgggaggagatgccatct
gagaggaagagagaggatgcggaggtgggaaaagatgcagagcctcatggagatgagaca
cgggagccgcttgtgacagagagatggaagctggctgtggcagatgctttgctgagctta
ggctctgtcatcgacattgcgggccttcaacaggctgtcaaggaggccctgtcagctgtg
ctccccagagtggagacggtctacacctacctgctggatggggagtccaggctggtgtgt
gaggaccctccgcatgagctgctccaggaggggaaagtccgagaggctgtgatctcccag
aaacggctgggctgcaatggactgggcccttcagacctgccagggaagcccttggccaga
ctggtggctccactggcccctggcacccaagtgctggtcataccgctggtggacaaggag
gccggggctgtggctggtgtcatcttggtgcactgtggccagctaagtgacagtgaggag
tggagcctgcagctctacgacctggacgcctcttccctgcagctgaaagttctccaatac
ctgcagcaggagaccggggcatcccggtgctgcctcctgctggtgtccgaggacaacctt
cagctttcctgcaaggtcattggagaaaaagtgctggaggaagagatcagctttccactg
acaatgggtcgcctgggccaggtggtggaagacaagaagtccatccagctgaaggacctc
acctctgaggatgtgcaacagctgcaaaacgtgctgggctgtgggctgcaggccatgctc
tgtgtccctgtcatcagccgggccactgaccaggtggtggccttggcctgcgccttcaac
aagcttggaggagacttgttcacagaacaggatgagcacgtgatacagcactgtttccac
tacacaagcaccgtgctcaccagcaccttggccttccagaaggagcagaaactcaagtgt
gagtgccaggctcttctccaagtggcaaagaacctcttcactcacctggatgacgtctct
gtcctgctccaggagatcatcaccgaggccagaaacctcagcaatgcggagatctgctcc
gtgttcctgctggatcagaacgagttggtggccaaggtgttcgacgggggcgtggtggat
gatgagagctacgagatccgcatcccggccgaccagggcatcgcgggccacgtggcgacc
actggccagatcctgaacatcccggacgcgtacgcgcacccgcttttctaccgcggcgtg
gacgacagcactggcttccgcacgcgcaacatcctctgctttcccatcaagaatgagaac
caggaggtcatcggcgtggccgagctggtgaacaagatcaatggaccttggttcagcaag
ttcgacgaggacctggcgacagccttctccatctattgtggcatcagcatcgcccactcc
ctcctgtacaaaaaagtcaacgaggcccagtatcgcagccacctggccaacgagatgatg
atgtaccacatgaaggtctctgacgacgagtacaccaaacttctgtataacgggatccag
cctgtggctgccattgactccaactttgcgagtttcacctacacccctcgatctctgccc
gaggatgacacgtccatggctatcctgagcatgctgcaggacatgaatttcatcaataac
tacaaaatcgactgcccaacactggcccggttctgtttgatggtgaagaaaggctaccgg
gaccccccctaccacaactggatgcacgccttttctgtctcccacttctgttacctactc
tacaagaacctggagctggcaaactacctcgaggacattgagatcttcgccttgtttatt
tcctgcatgtgtcatgacctggaccacagaggcaccaacaactccttccaggtggcctcg
aaatctgtgctggctgcactctacagctccgagggctctgtcatggagaggcaccacttc
gctcaggccatcgccattctcaacacccacggttgcaacatcttcgaccacttctcccgg
aaggactatcagcgcatgctggacctgatgcgggacatcatcttggccacagacttggca
caccacctccgtatcttcaaggatctccagaagatggctgaagtgggctatgaccgaacc
aacaaacagcaccacagcctcctcctctgcctccttatgacctcctgtgacctctctgac
cagaccaagggctggaagaccacaagaaagattgcagagctgatctacaaagagttcttc
tcccagggagacttggagaaggccatgggcaacaggccgatggagatgatggaccgggag
aaggcctacatccctgagctgcagatcagcttcatggagcacatagcaatgcccatctac
aagcttctgcaggacctgttccccaaggcggcagagctgtatgagcgtgtggcctcaaac
cgtgagcactggaccaaggtgtcccacaagttcaccatccgaggcctcccaagcaacaac
tcactggactttctggatgaggagtacgaggtgcccaagatggatggtgctgggggccct
gtcaatggctgctgcagccttgacgctgagtga

KEGG   Loxodonta africana (African savanna elephant): 100666579
Entry
100666579         CDS       T04351                                 

Gene name
PDE10A
Definition
(RefSeq) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
  KO
K18438  cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10 [EC:3.1.4.17 3.1.4.35]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04024  cAMP signaling pathway
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100666579 (PDE10A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100666579 (PDE10A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100666579 (PDE10A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100666579 (PDE10A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     100666579 (PDE10A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C HD H_kinase_N
Other DBs
NCBI-GeneID: 100666579
NCBI-ProteinID: XP_023415126
LinkDB
Position
Unknown
AA seq 792 aa
MEDGPSTNASCFRRLTECFLSPSLTDEKVKAYLSLHPRIDEFVSEGVAQRRRKCLKRKTT
TREDESAPREVSRYQDTNMQGVVYELNSYIEQRLDAGGDNQLLLYELSSIIKIATKADGF
ALYFLGECNNSLCVFTPPGIRDGKPRLIPAGPITQGTTISAYVAKSRKTLLVEDILGDER
FPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASV
AIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQV
DHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRF
NREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALAL
HCANMYHRIRHSECIYRVTMEKLSYHSICTAEEWQGLMRFTLPMRLCKEVELFHFDIGPF
ENMWPGIFVHMIHRSCGIACFDLEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQ
NNTGLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSI
LQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQSGSLNLNNQSHR
DRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKRDEV
PQGQLGFYNAVAIPCYTTLYQILPPTEPLLKACRDNLSQWEKVIRGEESPIWIVSQPVAP
EHATEKLVAPED
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggaagatggaccctctacaaacgcgagctgcttccgaaggctcaccgagtgcttcctg
agccccagtttgacagatgaaaaagtgaaggcatacctttctcttcaccccagaatagat
gaatttgtatctgaaggtgtagcgcagagacgtagaaaatgcctgaagagaaaaacaaca
accagagaggatgaatcggctcccagggaagtcagcaggtaccaagacacgaacatgcag
ggagttgtgtatgaactcaacagctacatagaacagcggttggatgccggaggagacaac
cagctgctcctctacgagctcagtagcatcatcaaaatagccacaaaagctgatggattt
gcactgtatttccttggagagtgcaataacagcctttgtgtgttcacaccacctggaata
agggatggaaaaccgaggctcatccccgccgggcccatcacccagggcaccaccatatct
gcctatgtggccaagtccaggaaaacactgctggtagaagacatccttggggatgaacga
tttccaagaggtactggactggagtcggggacgcgaatccagtctgttctttgtttgcca
atcgtcactgcaattggagatctgattggtattcttgagctgtataggcactggggcaag
gaagccttctgtctcagtcatcaggaggttgcaacagcaaacctagcctgggcgtcagta
gcaatacaccaggtgcaggtatgcagaggtcttgccaaacagactgagttgaacgacttt
ctcctcgacgtatcaaaaacatattttgataacatagtcgcaatagattctctacttgaa
cacataatgatatatgcaaaaaacctggtgaacgccgaccgttgtgcccttttccaggta
gaccataagaacaaggagttatattcagacctttttgatattggcgaggaaaaggaagga
aaacccgtcttcaagaagaccaaagaaataagattttcgattgagaaaggaatagccggc
caagtagcaagaacaggggaagtccttaacatcccagatgcctatgcagacccacgcttt
aaccgagaagtagacctgtacacaggctacaccacccggaatatcctgtgtatgcccatc
gtgagccgggggagcgtgatcggtgttgtccagatggtgaacaaaatcagtggaagtgcc
ttctctaaaacggatgagaacaacttcaaaatgtttgcggtcttttgtgctttagccttg
cactgtgctaatatgtatcataggatccgccactcagagtgcatctaccgggtcacgatg
gagaagctgtcctatcacagcatctgcactgcggaagagtggcagggcctcatgcgtttc
accctccccatgaggctctgcaaggaagtcgaactatttcactttgacatcggtcctttt
gaaaacatgtggcctggaatttttgtccatatgatccatcggtcctgtgggatagcctgc
ttcgaccttgagaagttgtgtcgctttatcatgtctgttaagaaaaactaccggcgtgtt
ccgtaccacaactggaagcatgccgtcaccgtagcccactgcatgtatgccatccttcag
aacaacacagggctcttcacagacctggagcgcaaagggctgctgatagcatgtctgtgc
cacgacctggaccacaggggcttcagtaacagctacctgcagaagttcgatcatccgctg
gcagcactgtactccacctccaccatggagcagcaccacttctcccagacggtgtccatc
ctccagttggaagggcacaatatcttctccaccctgagctccagcgaatacgaacaggtg
cttgagatcatccgcaaagccatcatcgctacagaccttgcgttatactttgggaacagg
aaacagttggaagagatgtaccagtctggatcgctaaaccttaataaccaatcgcataga
gaccgcgtaattggcttgatgatgaccgcctgtgatctttgttctgtgacaaaactgtgg
ccagtgacaaaactgacagcgaatgacatatacgcagaattttgggctgagggtgatgaa
atgaagaaactgggcatacagcctattcccatgatggacagagacaaaagagatgaagtc
ccacaaggccaacttggattctacaatgctgtggccatcccctgctacaccactctgtac
cagatcctcccgcccacggagccactccttaaagcctgcagggacaatctcagtcagtgg
gagaaagtcatccgaggagaggagagccccatatggatcgtgtcacagccggtggccccc
gagcacgccaccgagaagctcgtggcccctgaggactga

KEGG   Loxodonta africana (African savanna elephant): 100667448
Entry
100667448         CDS       T04351                                 

Gene name
PDE7B
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 7B isoform X2
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100667448 (PDE7B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100667448 (PDE7B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100667448 (PDE7B)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 100667448
NCBI-ProteinID: XP_010588740
LinkDB
Position
Unknown
AA seq 449 aa
MSCLMVERCGEILFENPDQNAKCVCMLGDVRLRGQTGVPAERRGSYPFIDFHLLNNTTHS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF
LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD
VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS
VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
KDLRLEDTHDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFELEIS
PLCNQQKDSIPSIQIGFMTYIVEPLFREWARFTGNSPLSENMLSHLAHNKAQWKSLLHKQ
PRSSSGSSPEHGGPGTEKEAHTGLDADGP
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgtcttgtttaatggttgagaggtgtggcgaaatcttgtttgagaaccctgatcagaat
gccaaatgtgtttgcatgctaggagatgtacgactaaggggtcagacaggggttcctgct
gaacgccgtggctcctacccattcattgacttccacctacttaacaatacaacacactca
ggggaaattggcaccaagaaaaaggtgaaaagactgttaagctttcaaagatacttccat
gcatcgaggctgcttcgtggaattataccacaagcccctctccacctgctggatgaagac
tacctgggacaagcaaggcatatgctgtccaaagtgggaatgtgggattttgacattttc
ttgtttgatcgcttgacaaatgggaacagcttggtaacactgctgtgccacctcttcaac
acccatgggctcattcaccacttcaagttagatatggtgaccttacacaggtttttagtc
atggttcaggaagactaccacagccaaaacccgtatcataatgctgtccacgcagccgat
gtcacccaggccatgcactgctacctgaaagagccaaagctcgccagtttcctcacgcct
ctggacatcatgcttggactgctggctgcagcagcacacgatgttgaccaccctggagtg
aaccagccatttctgatcaaaactaaccaccaccttgcaaacctatatcagaatatgtct
gtgctggagaatcaccactggagatctacaattggcatgcttcgagaatcaaggcttctg
gctcacttgccaaaggaaatgacacaggatattgaacagcagctgggctccttgatctta
gcaacagacatcaacaggcagaatgaatttttgaccagattgaaagctcacctccacaat
aaagatttaagactggaagatacacacgacaggcactttatgcttcagattgccttgaag
tgtgctgacatctgcaacccttgtaggatctgggagatgagcaagcaatggagcgaaagg
gtgtgtgaagaattctacaggcaaggtgacctcgagcagaaatttgaactggaaatcagt
cctctttgtaatcaacagaaagactcaatccctagtatacaaattggtttcatgacctac
atcgtggagccactcttccgggaatgggcccgtttcacaggaaacagcccactgtctgag
aacatgctgagccatctggcgcacaacaaggcccagtggaagagcctgttgcacaagcag
cccaggagcagcagcggcagcagcccggagcacggaggcccgggaaccgagaaggaggca
catactggcctggatgccgatggcccatag

KEGG   Loxodonta africana (African savanna elephant): 100667499
Entry
100667499         CDS       T04351                                 

Gene name
PDE4B
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4B
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04024  cAMP signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100667499 (PDE4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100667499 (PDE4B)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100667499 (PDE4B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100667499 (PDE4B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100667499 (PDE4B)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR DFP
Other DBs
NCBI-GeneID: 100667499
NCBI-ProteinID: XP_023405265
LinkDB
Position
Unknown
AA seq 564 aa
MKEHCGTFSNAVISGVSGDSAMDSLQPLQPNYMSVCLFAEESYQKLAMETLEELDWCLDQ
LETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPT
QKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVSTENEDHLAKELEDLNKWGLNI
FNVAGYSHNRPLTCIMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAA
DVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDE
SVLENHHLAVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTM
VETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDK
ERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWY
QSMIPQSPSPPLDERNRDCQGLMEKFQFELTLEEEDSEGHEKEGEGHNYFSSTKTLCVIH
PENRDSLEETDVEIATEDKSPIDT
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgaaggagcactgtggcaccttcagtaacgccgtgatcagcggagtcagcggtgactcg
gctatggacagtctgcagccgctccagcctaactacatgtctgtgtgtttgtttgcagaa
gaatcttatcaaaaattagcaatggaaacgctggaggaattagactggtgtctagatcag
ctagagaccatacagacctaccgctctgtcagtgagatggcttctaacaagtttaaaaga
atgctgaaccgggagctgacacacctgtcagagatgagccgatcagggaaccaggtgtct
gaatacatttcaaacactttcttagacaagcagaacgatgtggaaattccatctcccacc
cagaaagacagggagaaaaagaaaaagcagcagctcatgacccagataagtggagtgaaa
aaactgatgcacagttcaagcttaaacaatacgagcatctcacgctttggagttagcacg
gaaaatgaagaccatctggccaaggagctggaggacctgaacaaatggggccttaacatc
ttcaatgtggctggatattcacacaacaggcctctaacatgcatcatgtatgccatattc
caggaaagagacctcctaaagacattcaaaatctcatctgacacatttgtaacctacatg
atgactttggaagaccattaccattctgacgtggcatatcataacagcctacatgctgct
gatgtagcccagtcaacccatgttcttctttctacgccagcattagatgccgtcttcaca
gatttggaaattctggccgccatttttgcagctgctatccatgatgtcgatcatcctggc
gtctccaatcagtttctcatcaacacaaattcagaacttgccttgatgtataatgatgaa
tctgtcttggaaaaccaccaccttgccgtgggtttcaaactgctgcaagaagaacactgt
gacatcttccagaatctcaccaagaagcagcgtcagacactcaggaaaatggttattgac
atggtgttagcaacggatatgtccaagcatatgagcctgttggcagacctgaagacaatg
gtagaaacaaagaaagttacaagctcaggtgttcttctcctggataactatactgatcgt
atacaggtccttcgcaacatggtacactgtgcagacctgagcaaccccaccaaatccctg
gaattgtatcggcaatggacagaccgcatcatggaggaatttttccagcagggagacaaa
gagcgggagaggggaatggagattagcccaatgtgtgataaacacacagcttctgtggaa
aaatcccaggttggtttcattgactacattgtccatccactgtgggagacctgggcagat
ctggtacagcctgatgcccaggacattctggatacgttagaagataacaggaactggtat
cagagcatgataccccagagtccctccccaccactggacgagcgaaacagagattgccag
ggtctgatggagaagtttcagtttgaactgactcttgaagaagaggattcagaaggacat
gaaaaggagggagagggccacaactatttcagtagcacaaagacactttgtgtgatccat
ccagaaaatagggattccctggaagagactgatgtagagattgcgacagaagacaagtct
ccaattgacacataa

KEGG   Loxodonta africana (African savanna elephant): 100670699
Entry
100670699         CDS       T04351                                 

Gene name
PDE8B
Definition
(RefSeq) high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100670699 (PDE8B)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100670699 (PDE8B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100670699 (PDE8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100670699 (PDE8B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100670699 (PDE8B)
SSDB
Motif
Pfam: PDEase_I PAS_9 PAS PAS_3 PAS_4 PAS_8
Other DBs
NCBI-GeneID: 100670699
NCBI-ProteinID: XP_010586531
LinkDB
Position
Unknown
AA seq 761 aa
MRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNISRTPESALECFLDKHHEIIVIDH
RQTRNFDAEAVCRSIRATNPSEHTVILAVVSQASGDHEEASVLPLLHAGFNRRYMENSSI
IACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGY
HKGELLGKELAELPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPV
IGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTESHSFRHKNRRKESIDVKSIS
SRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRT
TELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITINDVP
PCIAQLLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWLQVI
EANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTN
SFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDSKCNIFKNIDRNHYRTLRQAIIDMV
LATEMTKHFEHVNKFVNSINKPIAAEIEGSDCECNPVGKNFPENQMLIKRMMIKCADVAN
PCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDM
FDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDN
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgagactgacacaggaccctatccaggttttgctgatctttgcgaaggaagatagtcag
agtgacggattctggtgggcctgtgacagagccggctacaggtgcaatatctctcggact
ccggagtcagcccttgagtgctttttagataagcaccatgaaattatcgttattgatcac
aggcaaactcgaaactttgatgcagaagctgtgtgcaggtcaatccgggccacaaatccc
tccgagcacacggtgatccttgcggtggtttcacaagcatcgggtgaccatgaagaggcc
tctgtccttccacttctccatgctggcttcaacaggagatatatggagaatagcagcata
attgcttgctataatgaactgattcaaatagaacatggggaagttcgctcacagttcaaa
ctacgggcctgtaattcagtgtttacagcattagaccactgtcatgaagccatagaaata
acaagcgatgaccatgtgatccagtatgtcaaccccgcctttgaaaggatgatgggctac
cacaaaggtgagctcctggggaaagaacttgccgagctgcccaaaagtgacaagaaccgg
gcagaccttctcgacaccatcaacacatgcatcaagaagggaaaggagtggcagggggtt
tactatgccagacggaaatccggagacagcatccaacagcatgtgaagatcacgccagtg
attggccaaggagggaaaattaggcattttgtctccctcaagaaactgtgttgtaccacg
gacaataataagcagattcacaagattcatcgtgattcaggagacaattctcagacagag
tctcattcattcagacacaagaacaggaggaaagagtccattgatgtgaaatcgatatct
tctcgaggcagcgatgcaccaagcctacagaaccgtcgctatccatccatggcaaggatc
cactccatgaccatcgaggctcccatcacaaaggtcataaatataatcaatgcagcccaa
gaaaacagccctgtcacagtagcagaagccttggatagggttttagaaattttacggacc
acagagctgtactcccctcagctgggtaccaaagatgaagatcctcacaccagtgatcta
gtcggaggcctgatgactgatggcttaagaaggttgtcaggaaatgagtatgtgtttact
aagaacgtgcaccagagtcacagtcaccttgcgatgccaataaccatcaacgatgttccc
ccttgtattgctcaattacttgataatgaggaaagttgggacttcaacatctttgaattg
gaagctgttacacataaaaggccattggtttacctgggcttgaaggtcttttcccggttt
ggagtatgtgaatttttgaactgttctgaaaccactcttcgggcttggctgcaagtgatt
gaagccaactaccactcctccaatgcctaccataactccactcatgccgccgatgtcctg
catgccactgctttcttccttggaaaggaaagagtaaagggaagcctagatcagctggat
gaggtggcagcactgattgctgccacagtccatgatgtggatcacccaggaaggaccaat
tccttcctctgcaatgcaggcagtgaactcgctgtgctctacaatgacactgctgtcttg
gagagtcaccacacagccctggccttccagctgacagtcaaggacagcaagtgcaacatt
ttcaagaatattgacaggaaccactatcgaacactgcgccaggctattattgacatggtc
ttagcaacggagatgacaaaacactttgaacatgtgaacaaatttgtgaatagtatcaac
aaaccaatagccgctgagattgagggcagtgactgtgaatgcaaccctgttgggaagaac
tttcctgaaaaccaaatgctgatcaagcggatgatgattaagtgtgctgatgtggccaac
ccatgccgccccttggacctgtgcattgaatgggccgggcggatctcagaggagtatttt
gcacagactgatgaagagaagagacaggggctacctgtggtgatgccagtgtttgaccgg
aacacctgtagcatccctaagtcccagatttccttcattgattacttcataacagacatg
tttgatgcttgggatgcctttgcacatctgccagccctgatgcaacatttggctgataac
tacaaacactggaagacattggatgacctaaagtgcaaaagtctgaggcttccatctgac
aactaa

KEGG   Loxodonta africana (African savanna elephant): 100671572
Entry
100671572         CDS       T04351                                 

Gene name
PDE4C
Definition
(RefSeq) LOW QUALITY PROTEIN: cAMP-specific 3',5'-cyclic phosphodiesterase 4C
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04024  cAMP signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100671572 (PDE4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100671572 (PDE4C)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100671572 (PDE4C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100671572 (PDE4C)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100671572 (PDE4C)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 100671572
NCBI-ProteinID: XP_023407625
LinkDB
Position
Unknown
AA seq 1093 aa
MADPHPPPPQLLLLLVLTVLLKCAGGFGTTPAGDPKVPESHRNPGVVVVVCLLVSVLLIG
SVVLALRRCHQGEAEFQRLDEVSMRTWESADSGSVPVSPLGAGVIRRRFSGTPLLPPLSN
RLGPPGEVEPDAPVLFTIEAQGPEWSHGPAPGRDSAIYVYLRRPEPLTLLPDPPCRCHWG
GLRTRHCSPLSFQHLLGGQRPGLGVCRNPCLSAQPSASAGPGQLLAVATTLIPLNLRSFS
FSTRERDSAAALEGGLLSPCLPAPHSAKTGGQFLPLPPQALLLSLFHSWPCGGGWSSQPL
PAPSFHPCHPSAPAGYGQLLGVFPTLXAPYSTFSRLSISIADSPSLSPXTPAPGRTQAAP
SPPRPSPLLWLMETPGVGEGAEASTGLSSARSRQGTARPPKHLWRQPRRPISIQQRFHSD
PDKSVRRSGLEKSRRSWPNSFPRRFDLENGLSCGRSALDTQASSGLGRASQTSAPHSQRR
ESFLYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAAFAHLQG
RGAAKYAEGGARRRGRDRSVRGKVPEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMA
SNKFKRMLNRELSHLSETSRSGNQVSEYIFQTFLDQQTEVELPRVTPVETPRPMSQISGL
RELPHSASLSTASVPRFGIQTDQEEQLAKELEDTNKWGLDVFRVAELSRNQPLTVIMFSI
FQERDLLKTFRIPAGTLITYLLTLESHYHADVAYHNSLHAADVAQSTHVLLATPALEAVF
TDLEVLAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLALGFKLLQTEN
CDIFQNLSAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVASLGVLLLDNYSD
RIQVLQNLVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERETGLDISPMCDKHTASV
EKSQVGFIDYIAHPLWETWADLVHPDAQGLLDTLEDNRAWYQSRIPCSPLAPRSPQRGGP
DRFQFELTLEEEEEEEEGEPVALDREASELPDIELLSPKTSPDPQIPQLDNQRTVGKPLT
DCEGNVMAKPFGT
NT seq 3282 nt   +upstreamnt  +downstreamnt
atggcggaccctcatccgccaccgccgcagctgctgctgcttctggtgctgacagtgctg
ctgaaatgtgctgggggtttcggtaccacccctgcaggtgaccccaaggtccctgagtca
cacagaaatccaggcgtggtggtggtggtgtgcctgctggtgtctgtcctgcttattggt
tccgtggtgctggccttgaggcgttgccaccagggggaggccgagttccagaggctggat
gaggtgtccatgcgaacctgggagtcagcagattctggctcggtccccgtgagccccctt
ggtgctggtgttatccggagacgtttctcagggactcccttgctgccaccgctgtcaaac
cgcctcgggcccccaggtgaggttgagcctgatgcccctgtcctgttcaccatcgaggct
caagggccagagtggagccacggtccagccccaggcagagactccgccatctatgtctac
ctccgaagaccagagcccttaactctgcttccagatcctccttgccgctgtcactgggga
gggttaaggacccgccactgttcacctctcagctttcagcatctcctgggcggacagcgc
cctggtctgggggtgtgtcgaaacccctgtctctctgcgcaaccttcagcatcagccggg
cccggacagcttctcgctgtcgcaactactctgatccccctgaaccttagaagcttctct
ttcagcaccagagagagggacagcgccgcggcgcttgaggggggtctcctgagcccctgc
cttcctgccccacattcagccaaaaccggagggcaatttctgcctctaccacctcaagcc
cttctcttgagcctcttccattcttggccctgcgggggggggtggtcttcccagcccctg
cctgccccatccttccacccctgccacccttcagcaccagccgggtacggacagctccta
ggtgtttttcctaccttataagccccttattctaccttctcccggcttagcatctccatc
gcagacagcccctcactgtcgcccngcacccccgcccctggtcggacccaggcggctccg
agccctcctcgcccctctcccctcctctggctcatggagacccccggggtcggcgaaggg
gcggaggcatccaccgggctgagcagtgctcgtagccgccaaggcacagccaggccgccg
aagcacctgtggcggcagccccggcgccccatcagcatccagcagcgcttccactcggac
ccggacaagtcggtgcgccggtccgggctggagaagtcgcggcgttcctggcccaactcc
ttccccaggcgctttgacctggaaaatgggctctcatgcgggaggagcgccctggatact
caggccagctcaggcctgggccgggccagccagacctctgccccccacagccagcggcgg
gagtccttcctgtaccgttcagacagcgactacgagctctcgcccaaggctatgtccagg
aactcctccgtggctagtgacctacatggagaggacatgattgtgacgccctttgcgcag
gtcctggccagtctgcggacggttcggagcaacgtggcggccttcgcccacctgcaaggc
cgcggggccgccaagtacgcagagggtggggccaggaggagggggcgggaccgctcggta
cgggggaaggtgccagaggacactgggcagaagttggcattggagacactggacgagttg
gactggtgcctggaccagctggagacgctgcagacacggcattcagtgggggagatggcc
tccaacaagttcaagcgaatgctgaaccgcgagttgagccacctgtcggaaaccagccgc
tctgggaaccaggtgtcggagtacatcttccagaccttcctggaccaacagactgaggtg
gagttgcccagggtgacccccgtggagaccccaaggcccatgtcccagatcagcggcctg
cgtgagctcccccacagtgccagcctctctactgcctctgtccctcgctttggcatccag
actgaccaggaggagcaactggccaaggagttggaagacaccaacaagtgggggcttgac
gtgttcagggtagcagagctaagcaggaaccagcccctcacagtcatcatgttcagcatc
tttcaggaacgggacctactcaagacattccggatcccagctggcacactcatcacctac
ctgctgacactggagagccactaccatgctgatgtggcctaccacaacagcttacatgct
gctgacgtggcacagtccacgcacgtgttgctggctacacccgccctcgaggctgtgttc
acagacctggaagtcctggctgccatctttgcaagtgctattcatgacgtggaccatcct
ggggtttccaaccagtttctgatcaacaccaactcagagcttgcactcatgtacaatgat
gcctccgtgctggagaaccaccacctggctctgggcttcaagctattgcagacagagaac
tgtgacatcttccagaacctcagtgccaagcagcggctgagcttgcgcaggatggtcatt
gacatggtgctggccacagacatgtccaaacacatgaacctactagctgacctcaagacc
atggtagagaccaagaaggtagccagcctcggcgtcctgctgctggacaactactctgac
cgcatccaggtcctgcagaacttggtgcactgtgctgacctcagcaaccccaccaagccg
ctgcccctgtaccgccagtggactgaccgcatcatggctgagttcttccagcagggtgac
cgggagcgcgagacaggcctggacattagccctatgtgtgacaagcacacggcctctgtg
gagaagtcccaggtgggtttcatagactacatcgcccacccactgtgggagacatgggcc
gaccttgtgcacccagatgcccagggcctgctggacacactggaggacaaccgcgcatgg
taccagagcaggatcccctgcagccccctggcccccagaagcccccagcgtggcggtcct
gacaggttccagtttgagctgaccctggaggaggaagaggaggaggaggaaggagagccg
gtggcattggatagggaggcttcagagttgcctgacattgagctcctgtcccccaagacc
agcccagacccccagatcccacagctggacaaccagaggaccgtgggcaagcctctcaca
gactgtgagggcaacgtgatggccaagccctttggcacctaa

KEGG   Loxodonta africana (African savanna elephant): 100671668
Entry
100671668         CDS       T04351                                 

Gene name
PDE4A
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4A
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04024  cAMP signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100671668 (PDE4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100671668 (PDE4A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100671668 (PDE4A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100671668 (PDE4A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100671668 (PDE4A)
SSDB
Motif
Pfam: PDE4_UCR PDEase_I
Other DBs
NCBI-GeneID: 100671668
NCBI-ProteinID: XP_023407662
LinkDB
Position
Unknown
AA seq 452 aa
MLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEILSPTMKEREKQHAPRQQRPPQHPP
PPVPQFQPMSQITGVKKLMHSSGLNSASIPRFGVKTDQEELLAHELENLNKWGLNIFRVS
DYAGVYNKTNCPSMYILRCFQFLFIFSFFFFLLVQELWWIWRSKIAGSSGTNVFFHFCRS
HSVVVPSAPGGNVLMLFLLPQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWYYS
AIRQSPSPPPEEEPGGPGHPPPPDKFQFELTLEEEEEEEVTTAQITATAQDASTVQELSL
AQKVPITAKDTSVIAPAASPAEKLLEVKGQDPSTEVEIEEVYLTRLADPAENGSMTQDQS
TSQDTSVALDAVSCSSPPVLFPESPPLSALRTPPPEEEAPGLLGLPSTAAEVGAQREHQA
AKRSCSVCTGTSSQDPATLPAPSEWGAGGGPT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgctaaaccgtgagctcacacacctgtcagaaatgagcaggtcaggaaaccaggtctct
gagtacatctccacaacattcctggacaagcagaacgaagtagagatcctatcacccacg
atgaaggagcgagagaaacagcacgcaccgcggcagcagcgacccccccagcaccccccg
ccccctgtgccgcagttccagcccatgtctcagatcacgggcgtcaagaaactgatgcac
agcagcggcctgaacagcgccagcatcccccgctttggggtgaagactgatcaagaggag
ctcttagcccacgagctggagaacctgaataagtggggcctgaacatcttccgtgtgtcg
gactacgccggagtttacaacaaaactaattgcccatccatgtacatattgaggtgtttc
cagtttttgtttatattctcatttttttttttcttacttgtgcaagagctttggtggatc
tggagaagtaaaattgctgggtcaagtggtacaaatgtcttttttcatttttgtagatct
cacagtgtggtggtgccatctgcaccaggaggcaacgtgttgatgctctttcttcttccc
caggtgggtttcattgactatatcgtgcacccgctgtgggagacatgggctgacctggtc
cacccagatgcccaggagatcctggacacactggaggacaatcgggactggtactacagc
gccattcggcagagcccttcaccaccgccggaggaggagcctggggggccaggccaccca
cccccacctgataagttccagtttgagttgactctggaggaggaagaggaggaggaggtg
accacagcccagataacagccacagcccaagatgcgtccacagtgcaagaactgtccttg
gcccaaaaagtgcccatcacagccaaggacacatctgtcatagccccggctgcatcccca
gctgagaagctgttggaggtcaagggccaggacccatccacagaggtagagatagaggaa
gtgtatttgacacggctggcagacccagccgagaatgggtctatgacgcaggaccagtcc
acgtcccaggacacatctgtggctctggatgctgtaagctgcagcagcccccctgtcctg
ttccctgaaagcccccctctgtctgccttgaggaccccaccccctgaagaggaggccccg
ggcctcctgggcctcccctccacggcggccgaggtgggggcccaaagggagcatcaggct
gccaagaggtcgtgcagtgtgtgcactgggacatccagccaggatccagccacattgcca
gctcccagcgagtggggggcaggtggaggccctacctga

KEGG   Loxodonta africana (African savanna elephant): 100673758
Entry
100673758         CDS       T04351                                 

Gene name
PDE7A
Definition
(RefSeq) high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A isoform X1
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100673758 (PDE7A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100673758 (PDE7A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100673758 (PDE7A)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 100673758
NCBI-ProteinID: XP_023401509
LinkDB
Position
Unknown
AA seq 483 aa
MYGPGNRSYLPYSLLCPQCTTHRSYAVSRWAQLILKMLTRRFLESLRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEFEVSVSARNIRRLLSFQRYLRS
SRFFRGTTVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL
HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLREPKLASSVTPW
DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HMPLENRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDVSHRHLVLQMALKC
ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPFCDRQSESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHMGLNKASWKGMQRVQTSSEDPEAALEELTSQLLPQEN
RSS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgtatggtccaggaaacagatcttatttaccttattcactcctgtgtccccagtgtaca
acacacagatcttacgctgtctcaagatgggcacaactgattcttaaaatgctgactaga
agatttctggagagccttaggcgtggagcgatctcctatgacagttctgatcagactgca
ttgtacattcgtatgctaggagatgtacgtgtaaggagtcgagcaggatttgaatcagaa
agaagaggttctcatccatatattgattttcgtatttttcactctcaatcagaatttgaa
gtttctgtctctgcaaggaatatcaggagattactaagtttccagagatatcttagatct
tcacggttttttcgtggtactacagtttcaaattctctgaacattttagatgacgattat
aatggacaagctaagtgtatgctggaaaaagttggaaattggaattttgatatctttcta
tttgatagactaacaaatggcaatagtctagtaagtttaacctttcatttatttagtctt
catggattaattgaatacttccatttagatatgatgaaacttcgtaggtttttagttatg
attcaagaagattaccatagtcagaacccttaccacaacgcagtccatgctgcggatgtt
actcaggctatgcactgttacttacgagaacccaagcttgccagttctgtaactccttgg
gatatcttgctgagcttaattgcagctgccacccatgatctggatcacccaggtgttaat
caacctttccttattaaaactaaccattacttggcaactttatacaagaatacctcagtc
ctggaaaatcaccactggagatccgcagtggggctactgagagaatccggcttgttctca
catatgccactagaaaacaggcaacaaatggagactcagataggtgctttgatacttgcc
acagacatcagtcgccaaaatgagtatctgtcattgtttagatctcatttggatagaggg
gacttatgcctagaagatgttagtcatcggcatttagttttacagatggctttaaaatgt
gctgatatttgtaacccatgtcggacctgggaactaagcaagcagtggagtgaaaaagta
actgaagaattcttccatcaaggagatatagaaaaaaagtatcatctgggtgtgagtcca
ttttgtgatcgtcagtccgaatccattgccaacatccagattggttttatgacttaccta
gtggagccattatttacggaatgggcgcggttttcaaataccaggctctcgcagacaatg
cttggccacatggggctgaataaagccagctggaagggaatgcagagagtgcagaccagc
agcgaggacccggaagctgcattagaggagttgacctcacagttattacctcaggaaaac
cggtcatcttga

KEGG   Loxodonta africana (African savanna elephant): 100674025
Entry
100674025         CDS       T04351                                 

Gene name
PDE1A
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A isoform X1
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04020  Calcium signaling pathway
lav04740  Olfactory transduction
lav04742  Taste transduction
lav04924  Renin secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100674025 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100674025 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100674025 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    100674025 (PDE1A)
   04742 Taste transduction
    100674025 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100674025 (PDE1A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100674025 (PDE1A)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 100674025
NCBI-ProteinID: XP_003406232
LinkDB
Position
Unknown
AA seq 545 aa
MGSPATETEELGNTTFKYLIGEQTEKMWQRLKGILRCLVKQLEKGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTDDELSDIESDSVPLEVRDWLASTFTRKMGMTKRKPEEKPKFRS
IVHAVQAGIFVERMYRKTSSVIGLSYPAAVIVTLKDVDKWSFDVFALNDASGEHSLKFMM
YELFTRYDLINRFKIPVPSLISYAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEINILANLSKDDWRDLRSLVIEMVLSTDMSGHFQQIKTIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKCWQLHHRWTMALMEEFFRQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAENSSFRTISASSVGGLKVTDALKQSNVKSS
ISDGSYFPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQGEPDLHRNSEDLVNAEEKH
TDTHS
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggggtctcctgccacagaaactgaagaattgggaaacaccacttttaagtatcttata
ggagaacagaccgaaaaaatgtggcaacggctgaaaggaatactaagatgcctagtgaaa
cagctggaaaaaggtgatgttaacgtcgtagacttaaagaagaatattgagtatgcagca
tccgtgttggaagcagtttatatcgatgaaacaaggagactgctggataccgatgatgag
ctctctgacattgagtctgattcagtcccattggaagtccgggactggttggcttctacc
tttacacggaaaatggggatgacgaaaaggaaacccgaggaaaaaccaaaatttcggagc
attgtgcatgctgttcaagctggaatttttgtggaaaggatgtacagaaagacctcttca
gtgattggtttgtcgtatccagcagctgttatagtaacattaaaggatgttgataaatgg
tcttttgatgtatttgccctaaatgacgcaagtggagaacacagtttgaagtttatgatg
tatgaactgtttaccagatatgatcttatcaaccgtttcaagattcctgttcctagccta
atatcctatgcagaagctttagaagttggttacagcaagtacaaaaatccatatcacaat
ttaattcacgcagctgatgtcactcaaactgtgcattacataatgcttcatacaggtatc
atgcactggctcactgaactggaaattttagcaatggtctttgccgctgccattcatgat
tatgagcatacagggaccacaaacaactttcatattcagacaaggtcagatgttgccatt
ttgtataatgaccgctccgttcttgagaatcaccacgtgagtgcagcctatcgacttatg
caagaagaagaaattaatattttggcaaatttatcgaaagatgactggagggatcttcgg
agcctggtgattgaaatggttttatctacggacatgtcaggtcacttccagcagattaaa
actataagaaacagtttgcagcagcctgaagggattgacagagccaagaccatgtccctg
attctccatgcagcagacatcagccatccagccaagtgctggcaactgcaccaccggtgg
accatggctctaatggaggagttcttccgacagggagataaagaagcggaactagggctt
ccattttcccctctctgtgatcggaagtcaacgatggtggcccagtcacaaataggtttc
attgacttcatagtagagccaacattttctcttctgacagactcaacagagaaaattgtt
attcctcttatagaggaagcctcaaaagccgaaaattcttcctttagaacaatcagtgca
agctccgttggggggttaaaagtgacagatgctttgaaacaatcaaatgtgaaaagcagc
ataagtgacgggtcctatttcccagactactcccttgcagcagtggacctgaagagcttc
aaaaacaacctggtggacatcattcagcagaacaaagagagatggaaagagttagctgca
caaggtgaacctgatcttcataggaactcagaagacttagtaaatgccgaagaaaaacat
actgatacacattcgtag

KEGG   Loxodonta africana (African savanna elephant): 100674033
Entry
100674033         CDS       T04351                                 

Gene name
PDE1C
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C isoform X1
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04020  Calcium signaling pathway
lav04740  Olfactory transduction
lav04742  Taste transduction
lav04924  Renin secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100674033 (PDE1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100674033 (PDE1C)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100674033 (PDE1C)
  09157 Sensory system
   04740 Olfactory transduction
    100674033 (PDE1C)
   04742 Taste transduction
    100674033 (PDE1C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100674033 (PDE1C)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100674033 (PDE1C)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 100674033
NCBI-ProteinID: XP_023400077
LinkDB
Position
Unknown
AA seq 654 aa
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SEEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNDAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDSAILYNDRSVLENH
HLSAVYRLLQEDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVNPVIEDTSQPAGTGQRRSSLNNITSSDAKR
SGVKSSGSEGSAPITNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEKQKEMEAKSQAEEGKAEKKTPGEAKNQVSGIRTSKSDNPRGKNSKAEKSSGEKQQ
NGDLKDGKNKSDKKDQSSVGNDSKKTDGTKRRSHSSPAPSTSSTSRLTLPGDYG
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggagtcaccaaccaaggagattgaagaatttgagagcaactctttgaaatacctgcaa
ccggaacagatcgagaaaatctggctgcggctccgaggactgaggaaatataagaaaacg
tcccagaggttacgctctttggtcaaacaattagaaagaggagaggcatcagtggtggat
cttaagaagaatttggaatatgcagccacagtacttgaatctgtatacattgatgaaacc
aggcgactcctggataccgaggatgagctcagtgacatccagtcagatgctgtgccatct
gaggtccgagactggctggcttccaccttcacacggcagatggggatgatgctcagaagg
agtgaggagaagcctcggttcaagagtattgtccatgcagtgcaggctgggatattcgtg
gagagaatgtatagacgaacatcaaacatggttggactgagctacccaccagctgttatc
gaagcattaaaggatgtggacaagtggtcttttgatgtcttttccctcaatgacgccagc
ggggaccacgcactgaaattcattttctatgaattactcacgcgctatgatctgatcagc
cgtttcaagatcccgatttctgcacttgtctcctttgtagaggctctggaagtgggatac
agcaagcataaaaacccttaccacaacctgatgcatgctgccgacgttacacagactgta
cattacctcctctataagacaggagtggcgaactggctgacggagctggagatcttcgct
atcatcttctcagctgccatccatgactacgagcataccggaaccaccaacaatttccac
attcaaactcgatctgattcagccattctgtacaacgataggtctgtactggaaaatcac
catttaagtgcagtctatcgtcttctacaagaagatgaggaaatgaatattttgatcaac
ctctcaaaggatgactggagggagtttcggaccttggtcattgagatggtgatggccaca
gatatgtcctgtcatttccagcaaatcaaagcaatgaagactgctctgcagcagccagaa
gcaattgagaagccaaaagccttatccctgatgctgcacacagcagatattagccatccg
gcaaaagcatgggacctccatcatcgctggacaatgtcacttctggaagagttcttcaga
cagggtgacagagaagcagagttggggctgcctttttctcctctgtgtgatcgaaagtca
accatggtcgctcagtcgcaagtaggcttcattgatttcattgtggaacccactttcact
gtgcttactgacatgacggagaagattgtgaaccctgtcatcgaggacacttcccaacct
gccgggacagggcagaggcgttcgagtttgaacaacatcacctcgtcagatgcaaagcgt
tcaggtgtcaagagctctgggtcagaaggaagtgcgccaatcaccaattccgtcatctct
gtcgactataagagtttcaaagccacttggaccgaggtggtgcatatcaaccgggagaga
tggagggccaaggtgcccaaagaggagaaagccaagaaggaagcagaggaaaaggctcgc
ctggccgcagaggagaagcaaaaggaaatggaagccaaaagccaggctgaagaaggcaaa
gctgagaaaaagacacctggggaagcgaagaatcaagtcagtggaatacgcacaagcaaa
agtgacaaccctcgagggaaaaattccaaagctgagaagtcatcaggagaaaagcagcag
aacggtgacttgaaagatggtaaaaataagtcagacaagaaggatcaatccagtgtcgga
aatgattcaaagaaaacagatgggacaaagcggcgttctcacagctctccagccccgagt
actagctccacaagtcgacttaccttgccaggggactacggataa

KEGG   Loxodonta africana (African savanna elephant): 100676113
Entry
100676113         CDS       T04351                                 

Gene name
PDE11A
Definition
(RefSeq) dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
  KO
K13298  dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 [EC:3.1.4.17 3.1.4.35]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04934  Cushing syndrome
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100676113 (PDE11A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100676113 (PDE11A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100676113 (PDE11A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100676113 (PDE11A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     100676113 (PDE11A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 HD
Other DBs
NCBI-GeneID: 100676113
NCBI-ProteinID: XP_003406019
LinkDB
Position
Unknown
AA seq 933 aa
MTTPGLDFGEVESFLDRHPELFEDYLLRKGKQEMVEKWLQRHSHGQGALGPRPTLAGTSS
LAHGGGRRSSIVGGGTGPNGSANSQPTPGGGDCSGVPLSPSWASGSRGDGSLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKSLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIQSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADTENSFKESMEKSSYSDWLINNSVAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNAKLKPMLDSVAV
NRSKWEELHQKRLLASAASPSPASLTVAAEDRK
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgacaacccctggcctggacttcggggaggtggaaagtttcctggacaggcacccagag
ttgttcgaagattacctgttgcggaaggggaagcaggagatggtggagaagtggctgcag
aggcacagtcatggtcagggggctttaggcccaaggcccactctggctggcaccagcagc
ttggctcatggcggtggcagaagaagcagcatcgttggtggtggcactggaccaaatggc
tctgccaacagccagcctactcctggtggtggggactgtagtggggttcctttgagtccc
agctgggccagtggcagccgaggtgatgggagcctgcagcgaagagcttctcagaaagag
ctaaggaagagttttgctcgctccaaggccatccatgtgaacaggacctacgatgaacag
gtgacctcccgggcccaagagcccctgagcagtgtgcggcggagggcgctgctccggaag
gcgagctctctgccccccaccacagcccacattctcagtgccctactggaatcgagggtg
aatctgcctcagtacccccctacagccatcgattacaagtgccatctcaaaaagcacaat
gagcgtcagttcttcctggaactggtcaaggatatctccaatgaccttgacctcaccagc
ctgagctacaagatcctcatctttgtctgcctcatggtagatgctgaccgctgctctctc
ttcttggtggaaggggcagctgctggcaagaagagcttggtctccaaattctttgatgtg
catgcaggaaccccactgctgccgtgcagcagcacagagaactcaaatgaggtgcaggtc
ccctggggcaaaggcatcattggctatgtcggggagcatggagaaacggtcaacattcct
gatgcctaccaggatcgaagattcaatgatgaaattgacaagctaactggatacaagaca
aaatcattactgtgcatgcctatccaaagcagtgatggcgagattatcggtgtggcccaa
gcaataaataagattcctgaaggtgctccatttactgaagatgacgaaaaagttatgcag
atgtaccttcctttttgtggaattgccatatccaatgctcaactctttgctgcctcaagg
aaagaatatgaaagaagcagggctttactagaggtggttaatgatctctttgaagaacag
actgacctggagaaaatcgtcaagaaaataatgcatcgggcccagactctgttgaaatgt
gaacgctgttctgttttactcttagaggacattgagtcaccagtggtgaagtttaccaaa
tcctttgaattgatgtccccaaaatgcagcgctgatactgagaacagtttcaaagaaagc
atggagaaatcatcatactcagactggctaataaataacagtgtggctgagctggttgct
tctacgggcctcccagtgaacatcagtgatgcctaccaggatcctcgctttgatgctgag
gctgaccagatatccggttttcacataagatctgttctctgcgttcctatttggaatagc
aaccaccaaataattggggtggctcaagtgttaaatagattggatgggaaaccttttgat
gatgcagatcagcgactttttgaggcttttgtcatcttttgtggccttggcatcaacaac
acaattatgtatgatcaagtgaagaagtcctgggctaagcagtctgtggctcttgatgtg
ctgtcctaccatgcgacatgttcaaaagctgaagttgacaagtttaaggcagccaacatc
cctctggtgtcagaacttgccatcgatgacatacattttgatgacttttctctcgacgtt
gacgccatgatcacggctgctctccggatgttcatggagctggggatggtacagaaattt
aaaatcgactatgagactctgtgtaggtggcttttgacagtgaggaaaaactatcgcatg
gttctgtaccacaactggagacatgccttcaacgtgtgccaactgatgttcgcgatgtta
actactgcagggtttcaagagattctgaccgaggtggaaattttagctgtgattgtgggc
tgcctgtgtcacgacctcgaccacaggggaaccaacaatgccttccaagctaagagcggc
tctgccctggcccagctctatggaacctctgccaccctagagcatcaccattttaaccat
gcagtgatgatccttcagagtgagggtcacaacatctttgctaatttgtcctccaaggaa
tatagcgaccttatgcagcttttgaagcagtcaatcttggcaacagacctcacgctgtac
tttgagaggagaaccgaattctttgaacttgtcagtaaaggtgaatatgattggaacatc
aaaaaccatcgtgatatatttcgatcaatgttaatgacagcctgtgaccttggagccgtg
accaaaccgtgggagatctccagacaggtggctgaacttgtaaccagtgagttctttgaa
caaggagatcgggagagatcagaactcaaactcactccttcagctatttttgatcggaac
cggaaagatgaactgcctcgattgcaattggaatggattgatagcatctgcatgcctttg
tatcaggcattggtgaaggtcaatgcgaaactgaagcccatgctggattcggtggctgtg
aacagaagtaagtgggaagagctgcaccagaaaaggctgctggcttcggccgcctcgccc
tctcctgccagcctcacggtggctgcagaggacagaaagtaa

KEGG   Loxodonta africana (African savanna elephant): 100677239
Entry
100677239         CDS       T04351                                 

Gene name
PDE1B
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B isoform X2
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04020  Calcium signaling pathway
lav04740  Olfactory transduction
lav04742  Taste transduction
lav04924  Renin secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100677239 (PDE1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100677239 (PDE1B)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100677239 (PDE1B)
  09157 Sensory system
   04740 Olfactory transduction
    100677239 (PDE1B)
   04742 Taste transduction
    100677239 (PDE1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100677239 (PDE1B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100677239 (PDE1B)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 100677239
NCBI-ProteinID: XP_003405119
LinkDB
Position
Unknown
AA seq 517 aa
MATPVPVQRSHLQGPILRLRYMVKQLENGEVNIEELKKNLEYTASLLEAVYIDETRQILD
TDDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFR
RTYTSVGPTHSTAVLHCLKNLDLWCFDVFSLNRAADDHALRTIVFELLTRHSLISRFKIP
TVFLMTFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIEVLAIIFAA
AIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVFRMMQDDEMNIFINLTRDEF
VELRALVIEMVLATDMSCHFQQVKSMKTALQQLERIDKPKALSLLLHAADISHPTKQWSV
HSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVA
EKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGEPNPDVVSFRSTWTKHIQENKQKWKERA
ASGITNQMSIDELSPCEEEEALSSPVEDEHNQNGNLD
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcaacccctgttcctgtgcagaggagccacctccagggcccgatcctcaggctgcgc
tacatggtgaagcaattggagaatggggaggtaaacatcgaggagctgaagaaaaacctg
gaatacacagcttctctgctggaggctgtctatatagacgagacacggcaaatcttggat
acggatgatgagctgcaggagctgcggtcagacgctgtgccttcggaggtacgggactgg
ctggcctccaccttcacccagcaagcccgggccaaaggccgccgagcagaggaaaagccc
aagttccgaagcattgtgcatgctgtgcaggctgggatcttcgtagaacggatgttccgg
agaacgtacacgtctgtgggccccacccattccacggcggtcctccactgtctcaagaac
ctggacctctggtgctttgatgtcttttccttgaaccgggcagcagatgaccacgccctg
aggaccattgtttttgagctgctgactcggcatagcctcatcagccgcttcaagattccc
actgtgtttctgatgactttcctggatgccttggagacgggctatgggaagtacaagaat
ccttaccacaaccagatccatgcagctgatgttacccagacagtccattgcttcttgctc
cgcacagggatggtgcactgcctgtcggagattgaggtcttggccatcatctttgccgca
gccatccatgactacgagcacacaggcactaccaacagcttccacatccagaccaagtca
gaatgtgccatcctgtacaatgatcgttcagtgctggagaatcaccacatcagctctgtt
ttccgaatgatgcaggatgacgagatgaacattttcatcaacctcaccagggatgagttt
gtagagctgcgtgccctggtcattgagatggtgttggccacagacatgtcctgccacttc
cagcaagtgaagtccatgaagacagccttgcagcaactggagaggatcgacaaacccaag
gccctgtctctactgctccatgctgctgacatcagccacccaaccaagcagtggtcggtc
cacagccgctggaccaaggcccttatggaggaattcttccgtcagggtgacaaggaggca
gagctgggcctgcccttttctccgctctgtgatcgcacttccactctcgtggcacagtcc
cagattggtttcattgacttcattgtggagcccacgttctctgtgctcactgatgtggca
gagaagagtgtgcagcccctggcagatgaggactccaagtctaaaaaccagcccagcttc
cagtggcgccagccttctctggatgtggaagtgggagagcccaatcctgacgtggtcagc
ttccgctccacttggaccaagcacattcaggagaacaagcaaaaatggaaggaacgggca
gcaagtggtatcaccaaccagatgtccattgatgagttgtccccatgtgaggaggaggag
gccctgtcctcccctgtggaagatgaacacaatcagaatgggaatctggactag

DBGET integrated database retrieval system