KEGG   Loxodonta africana (African savanna elephant): 100656582
Entry
100656582         CDS       T04351                                 

Gene name
UCP1
Definition
(RefSeq) LOW QUALITY PROTEIN: mitochondrial brown fat uncoupling protein 1
  KO
K08769  solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03320  PPAR signaling pathway
lav04371  Apelin signaling pathway
lav04714  Thermogenesis
lav05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100656582 (UCP1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100656582 (UCP1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100656582 (UCP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100656582 (UCP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100656582 (UCP1)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100656582 (UCP1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 100656582
NCBI-ProteinID: XP_023404267
LinkDB
Position
Unknown
AA seq 513 aa
MLCTIRRLINDSNLWADTLEGITIRLATSVPVASPTQVWLINLNCKPGPGSVTLAHTDLL
FTSSLLLARRAETGPFGDATLSPTVLSNLRRTFSYFLELLSDGEIQLFTVKVVLMKQQRA
GTCHCQLLEKSSLRVAGLYKSPSWGRGARCSPALGAVGPPGTRVGRRQTRPESAPLLRSA
CSRLLAHLPRLQPPPRGPSQMKTVGQTTADVPRTMVGVKIFSAGVAACLADVITFPLVAA
KVRLQIESEIQGECQTSSAIRYKGVLGTITTLAKKEEPMKLYSGLPAGLQRQISFASLRT
GLYDMAQEYSTAEKESNNLESKIAAGLRTGGVAVFTGXPTEVVEARLQAQSHLHGLKPCY
TGTYNADRIIATTEGLTGLWKGTTLNLTRNIIISCTELVTYDLMKETFVKNNLLADDVPC
HLVSALIAGFCTMVLSSPADVVKTRFINSPPGYYTSVPKCAVTMFTKKGLPAFFNGLVPS
FLRLGSWNAIMFLCSEQLKQELMKSRQTMGCTT
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgctgtgtaccatcagacgtctaataaatgattccaacctctgggctgatactcttgaa
ggcatcactattcgcctggcgacaagtgtcccagttgcaagcccaacacaagtgtggctg
ataaatttaaattgtaagccaggtcctggttcagttacccttgctcacactgacctactc
tttacctcttcacttctacttgccagaagagcagaaacaggaccctttggggatgccacc
ctctcccctactgttctctccaacctgaggcgaactttctcctacttcctagagcttctc
agtgatggtgagatccagctcttcaccgtgaaggtagtgttgatgaagcagcaaagagcg
ggtacatgccactgccagcttcttgaaaagtccagcctccgagtggccgggctatataag
tcaccctcctggggcaggggcgcacggtgctcgccagccctgggagcggtgggtcctcct
ggcacgagggtggggaggaggcagacgcggccggaatcggccccactactgcgctccgcg
tgcagccgactgctggcgcacctgccacggctgcagccaccgcctcgtggaccgtcccag
atgaagaccgtaggccagacgaccgcagacgtgccccggaccatggtgggggtcaagatc
ttctcagcgggagtggcggcctgcttggcagatgtaattaccttcccgctggtcgcggcc
aaagttcggctgcagatagagagcgaaatccaaggtgaatgccagacctccagtgccatt
aggtataaaggtgtcctgggaacaatcactactctggcaaaaaaggaagagccaatgaaa
ctctatagtgggctgcctgctggccttcagagacaaataagctttgcctctcttaggact
ggcctctatgatatggcccaggagtattccactgcagagaaagaaagtaacaatttagaa
agcaagatcgctgctggcttaaggactggaggagtggcagtgttcactggcnaacccaca
gaggtcgtggaggctagacttcaagcacagagccatctacatggtctcaaaccgtgctac
actgggacttacaatgctgacagaatcatagcaacaacagaaggcttgacaggtctttgg
aaagggactactctcaatctgacaagaaatatcatcatcagttgtacagagctagtaaca
tatgacctgatgaaggagacctttgtgaaaaacaacctactagcagatgacgtgccctgc
cacttagtgtctgctcttatcgctggattttgcacaatggttctgtcctctccagcagat
gtggtgaaaaccagatttattaattctccaccaggatactacacgagtgtacccaaatgc
gcagtgaccatgttcaccaagaaaggactgccggcttttttcaacgggcttgtgccttcc
ttcttgcgactgggatcctggaacgccattatgtttttgtgctctgaacagctgaaacaa
gaattgatgaagtcaaggcagactatgggctgtaccacataa

DBGET integrated database retrieval system