KEGG   Loxodonta africana (African savanna elephant): 100657004
Entry
100657004         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: deleted in malignant brain tumors 1 protein-like
  KO
K13912  deleted in malignant brain tumors 1 protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100657004
SSDB
Motif
Pfam: SRCR Zona_pellucida CUB SRCR_2
Other DBs
NCBI-GeneID: 100657004
NCBI-ProteinID: XP_023415611
LinkDB
Position
Unknown
AA seq 1266 aa
MPSFGWEPINTKVFLLKLRSKMIPSKMGTSTFILGVCLLWGQILTAGRLHGQRKEGHRER
WQRKAKQSVCRRVCSRRAYAGLPLKLADRGSWCQGHVGVLYQGYWGSVCVDSWDIQDARV
ICQQLSCGLVKAQGTSSWVTCAAQDGSPPCRAAPTTNVSTRKMLELCAQVVPTSPCAVTY
FLGTESGLALRLVNGGDRCQGRVEVLYRGSWGTVCDDLWDTNDANVVCRQLGCGWAISAP
GNARFGQGSGQIVLDDVRCSGHESYLWSCPHRGWLSHNCGHHEDAGIICSGGPPDHSATF
WAVVPTTPRPRPPGSQHPTAVIEDSLGTGSGLALRLVNGGDRCQGRVEVLYQGSWGTVCD
DDWDTNDANVVCRQLGCGWAISAPANAQFGQGSGQIVLDDVRCSGHESYLWSCPHRGWLS
HNCGHHEDAGVICSDALASTFYFFPPTETWPVTVLGQSPDMTDSGLALRLVNGGDRCQGR
VEVLYQGAWGTVCDDLWDTNDANVVCRQLGCGWAISAPGNALFGRGSGQIVLDNVRCSGH
ESYLWSCPHGGWLSHNCGHSEDAGVICSASQNQSTARPDMDEKFLCPLVGTDSSXALSLV
NGCDRCQGCMEVLYQXSWGTVWDDSWDFSHHSRLGEIHPAAGFSGLDLRINRWGQGMSQS
VWLCLSHKPTSRSRDKRGSEGIMCSPSKFAWVSVCRVTVLGQSPDTLQELSQGLYISEKF
LCPLPETDSGLALRLVNGGDRCQGRVEVLYQGSWGTVCDDLWDTNDANVVCRQLGCGWAI
SAPGNARFGQGSGQIVLDDVSCSGHESYLWSCPHRGWLSHNCGHYEDAGVICSGSYVTTP
APFSDTTRPTSNYSCGGFLSQTSGQFSSPFYPGNYPNNARCIWDIEVRSNHRVTVVFRDV
QLESGCNYDYIEVFDGPYHSSPLIARVCNGVSGSFTSSSNFMSVRFISDGSVTRKGFQAE
YYSSPSNDSTKLLCLQNHMQALVSRSYLRSLGYVAQDLVIPGWSRSYQCQPQITSSQVIF
TIPYVGCGTIKQADNDTIIYSNILKATVSNGIIKRKKDLNIRTSCRMLQNAWVDTMYIAN
DTIEVKEIQYGNFNVNISFYTSSSFSYPVTSSPYYVDLNQDLYLQAEIRHSDSSLALFVD
TCVASPYPNDFTSLTYDLIRSGCVKDQTYRSYPQPSPRIARFKFSSFHFLNRFPSVYLKC
KMVVCRAYDYNSRCYRGCVVRSKRNAGSYQEKVDVVLGPVQLRVPEQWSLGRLSPSDLTE
NQGPAP
NT seq 3801 nt   +upstreamnt  +downstreamnt
atgccctctttcggctgggaacctataaataccaaggtatttttactcaaattgagaagc
aaaatgatccccagcaaaatggggacctccacgttcatccttggagtgtgtcttttatgg
ggtcaaattctgactgcagggcgtctgcatggtcagaggaaggagggacacagggagcgc
tggcagaggaaagccaagcagagtgtgtgcagacgagtgtgttcccgccgtgcctatgca
ggcttgccactgaagctggcggacagagggagctggtgtcagggccatgtgggggtcctg
taccaaggctattggggcagtgtgtgtgtcgacagctgggacatccaggatgcacgcgtc
atctgtcagcagctcagctgtggcttggtgaaagctcagggaacatcctcttgggtgacg
tgtgctgctcaggatgggagccctccctgtcgagctgcccccacaacgaatgtgtccaca
aggaagatgctggagttgtgtgctcaggtagtcccaacgtcaccctgtgctgtcacctac
ttcctagggacagaatctggtttggctctgaggctggtgaatggaggtgaccggtgtcag
ggccgcgtggaggttctgtaccgaggctcctggggcaccgtgtgtgatgacctctgggac
accaatgatgccaacgtggtctgcaggcagctgggctgtggctgggcgatatcagctcca
ggaaatgcccggtttggtcagggctcaggacagatcgtcctggacgatgtgcgctgctcg
ggacatgagtcctacctatggagctgtccccacagaggttggctctctcataactgtggt
caccatgaggatgctggcatcatctgctcaggtgggcctccagatcactcagccaccttc
tgggctgtggtgcccaccactccccgacccaggccaccaggttcgcagcacccaacagct
gtgatagaagactccctagggacaggatctggtttggctctgaggctggtgaatggaggc
gaccggtgtcagggccgcgtggaggttctgtaccaaggctcctggggcaccgtgtgtgat
gatgactgggacaccaatgatgccaacgtggtctgcaggcagctgggctgtggctgggcc
atttcagccccagcaaatgcccagtttggtcagggctcaggacagatcgtcctggacgat
gtgcgctgctcaggacatgagtcctacctatggagctgtccccacagaggttggctctct
cataactgtggtcaccatgaggatgctggcgtcatctgctcagatgcattggctagtacc
ttctacttttttcctcctacagagacatggcccgtcactgtccttggccagagcccagac
atgacagattccggtttggctctgaggctggtgaatggaggtgaccggtgtcagggccgt
gtggaggttctgtaccaaggcgcctggggcaccgtgtgtgatgacctctgggacaccaat
gatgccaacgtggtctgcaggcagctgggctgtggctgggccatatcagctccaggaaat
gccctgtttggtcggggttcaggacagattgttctggacaatgtgcgctgctcgggacac
gagtcctacctgtggagctgcccccacggaggctggctgtctcataactgtggacacagt
gaggatgccggtgtcatctgctcagcttcccagaaccagtccacggccaggccagacatg
gatgagaaattcttgtgccctcttgtagggacagattccagttaggccctgagtttggtg
aatggatgtgaccggtgccagggttgcatggaggtcctgtaccaantgtcctggggcacg
gtgtgggatgacagctgggattttagtcatcatagtaggctgggtgaaattcatccagct
gctggcttctcaggactggatctcagaatcaaccgctggggccagggaatgagtcagtct
gtttggctgtgtctgagtcacaagcccacctcccggtctagggacaagagggggagtgaa
ggtataatgtgctctccaagcaaatttgcctgggtcagtgtctgtcgggtcactgtcctt
ggccagagcccagacacacttcaggaattatcccaaggtttatacatcagtgagaaattc
ttgtgccctcttccagagacagattccggtttggccctgagattggtaaatggaggtgac
cggtgtcagggccgcgtggaggttctgtaccaaggctcctggggcactgtgtgtgatgac
ctctgggacaccaatgatgccaacgtggtctgcaggcagctgggctgtggctgggccata
tcagctccaggaaatgcccggtttggtcagggctcaggacagatcgtcctggacgatgtg
agctgctcaggacacgagtcctacctgtggagctgtccccacagaggttggctctctcat
aactgtggtcactatgaggatgctggcgtcatctgctcagggagctacgtaaccacacct
gctcccttttcagacaccacccgcccaaccagtaattattcctgcggaggcttcctttcc
caaacatcagggcagttttccagcccattctatcctgggaactatccaaacaatgccagg
tgtatctgggatattgaagttcgcagcaaccaccgagtcaccgtcgtcttcagagatgtc
cagctggaaagtggctgcaactatgattacatcgaagtctttgatgggccctaccacagt
tcccctctcattgctcgggtttgtaatggcgtaagcggctccttcacttcgtcgtcgaac
ttcatgtctgtccgcttcatcagcgacggcagtgtcacaaggaaaggcttccaggccgag
tactactcgagtccttctaatgatagcaccaagctgctgtgtctgcagaatcacatgcaa
gccctggtgagcaggagctacctccgatctctcggttacgtggctcaggatctcgtcatc
cctggctggtccaggagctatcagtgtcagccccagataacatcgagccaggtgatattc
acaattccctatgtgggctgtggcaccatcaaacaggcagacaatgataccatcatctat
tccaacattcttaaagcaactgtttcaaatggcatcatcaaaaggaagaaggacttgaac
atccgcaccagctgcagaatgctgcagaacgcctgggttgacaccatgtacattgctaat
gacaccatcgaggtcaaggaaatccagtatggcaacttcaacgtcaacatctccttttac
acgtcctcttcattctcctatcctgtgaccagctccccgtactacgtggacttgaaccag
gatttgtaccttcaggctgaaatccgtcattccgattcctccctggccttgtttgtggac
acctgtgtggcatcaccataccccaatgactttacatctctgacttatgacctaatccgg
agcgggtgtgtgaaagaccaaacctacagatcctacccccagccctcaccccgcatcgcc
cgcttcaaattcagctccttccacttcctgaaccgcttcccctccgtgtatctgaagtgt
aagatggtggtgtgcagggcctatgactacaactcccggtgctacaggggctgtgtggtg
aggtccaagaggaacgcaggctcctaccaggagaaggtggatgtcgttctgggccctgtt
cagctgcgggtcccagagcagtggagcctgggtaggttatcgccttctgacctcactgaa
aaccaggggccagccccataa

DBGET integrated database retrieval system