KEGG   Loxodonta africana (African savanna elephant): 100657419
Entry
100657419         CDS       T04351                                 

Gene name
KCNN4
Definition
(RefSeq) intermediate conductance calcium-activated potassium channel protein 4
  KO
K04945  potassium intermediate/small conductance calcium-activated channel subfamily N member 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04911  Insulin secretion
lav04929  GnRH secretion
lav04970  Salivary secretion
lav04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100657419 (KCNN4)
   04929 GnRH secretion
    100657419 (KCNN4)
  09154 Digestive system
   04970 Salivary secretion
    100657419 (KCNN4)
   04974 Protein digestion and absorption
    100657419 (KCNN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100657419 (KCNN4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100657419 (KCNN4)
SSDB
Motif
Pfam: CaMBD SK_channel Ion_trans_2 Ion_trans Ribosomal_S18
Other DBs
NCBI-GeneID: 100657419
NCBI-ProteinID: XP_023398908
LinkDB
Position
Unknown
AA seq 364 aa
MISISTFLLLCFIVAFHAKEIQLFMTDNGLRDWRVALTGRQAVQIVLELAVCGLHPAPLR
GPPCMQGAGSPRGAAQSWPGFLSQEEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIG
ALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDTLWL
IPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFMM
DIQYTKEMKESAARVLQEAWMFYRYTHRKDSGAARRHQRRLLTAISTFRQVRLKHRKLRE
QVNSMVDISKMHMILCDLQLGLSSSHQALEKRMDTLAGKLDALTELLSTALGPRQLPESS
QEAT
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgatcagcatttccaccttcttgctcctttgctttatcgtggcctttcacgccaaagag
atccagctgttcatgaccgacaacgggctccgggactggcgcgtggcgctgaccgggcgg
caggcggtgcagatcgtgctggagctggcggtgtgcgggctgcacccggcgcccttgcgg
ggaccgccttgcatgcaaggcgcgggctcgccgcggggggcggcgcagagctggcccggc
ttcctgagccaggaggaggcgctgctgtcgctggccatgctgctgcgcctctacctggtg
ccccgcgctgtgcttctgcgcagcggcgtcctgctcaacgcttcttaccgcagcatcggc
gccctcaaccaagtccgcttccgccactggttcgtggccaagctgtacatgaacacgcac
cccggccgcctgctgctcggcctcacgcttggcctctggctcaccaccgcctgggtgctg
tcggtggcagagagacaggctgttaatgccactggtcacctttcggacacgctgtggctg
atccccatcacatttctgaccattggctatggggacgtggtgccgggcaccatgtggggg
aagatcgtctgcctctgcaccggggtcatgggggtctgctgcacagccctgctggtggcc
gtggtggcccggaagctggagtttaacaaagcggagaagcacgtgcacaacttcatgatg
gacatccagtataccaaagagatgaaagagtccgctgcccgagtgctgcaagaggcctgg
atgttctacagatatacacacaggaaggactctggagctgcccgtaggcatcagcgcagg
ctgctgactgccatcagcacgttccgccaggtgcggctgaaacaccggaagctccgggaa
caagtgaactccatggtggatatctccaagatgcacatgatcctgtgtgacttgcagttg
gggctgagcagctcccaccaggccctggagaagcgcatggacaccctggcaggaaagctg
gacgccctgactgagctgctcagcactgccctggggccacgacagcttccagaatccagc
caggaggccacatag

DBGET integrated database retrieval system