KEGG   Loxodonta africana (African savanna elephant): 100657644
Entry
100657644         CDS       T04351                                 

Gene name
PLAT
Definition
(RefSeq) tissue-type plasminogen activator
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04371  Apelin signaling pathway
lav04610  Complement and coagulation cascades
lav05202  Transcriptional misregulation in cancer
lav05215  Prostate cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100657644 (PLAT)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100657644 (PLAT)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100657644 (PLAT)
  09162 Cancer: specific types
   05215 Prostate cancer
    100657644 (PLAT)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100657644 (PLAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100657644 (PLAT)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100657644 (PLAT)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     100657644 (PLAT)
Peptidases and inhibitors [BR:lav01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100657644 (PLAT)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100657644 (PLAT)
SSDB
Motif
Pfam: Trypsin Kringle fn1 EGF DUF1986 Trypsin_2 hEGF AbiTii
Other DBs
NCBI-GeneID: 100657644
NCBI-ProteinID: XP_010590733
LinkDB
Position
Unknown
AA seq 563 aa
MNKMKQELVCLLLLCGVVFTLSSQESRARFGRGARSYSVTCRDEKTQMTYLHHESWLRPV
IRSNRVEYCWCNSGRAQCHSVPIKSCSEPRCFNGGTCKQAVYFSDFVCQCPEGFVGKRCE
IDTNATCYKDQGVTYRGTWSTAESGAECLNWNSSALALKPYNGRRPDAVRLGLGNHNYCR
NPDRDSKPWCYIFKEGKYTSEFCSTPACANEKKEDCYFGKGLDYQGTHSITTSGATCLQW
DSLTLIGKIYTAWNSNAQALGLGKHNYCRNPDGDAKPWCHVLKDHKLTWEYCDVPQCSTC
GLRQYKQPQFRIKGGLYTDITSHPWQAAIFVKNRRSPGERFLCGGTLINSCWVLSAAHCF
QERFPSHHVKVVLGRTYRLVPGEEEQKFEVEKYIVHKEFDDDTYNNDIALLRLKSDSSYC
AQESNTVRPVCLPEASLQLPDWTECELSGYGKHESTSPSYSERLKEAHIRLYPSSRCTSQ
HMFNKTVTNNMLCAGDTRSGGSQVNLHDACQGDSGGPLVCMTDKRMTLVGIISWGIGCGQ
KDVPGVYTKVANYLDWIQDNMRP
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgaataaaatgaagcaagaactcgtgtgtctattgctgctttgtggtgtagtcttcact
ctgtccagccaggaaagccgcgcccgatttggaagaggggccaggtcttacagtgtgacc
tgcagagatgaaaaaacacagatgacgtacctgcatcacgagtcgtggctgcgtcccgtg
atcagaagcaaccgggtggagtactgctggtgcaacagtggcagggcacagtgccactcc
gtgcccatcaaaagttgcagtgaaccaaggtgtttcaatggggggacgtgtaagcaggct
gtctatttctcagattttgtctgccagtgccctgaaggatttgtggggaaacgctgtgaa
atagacaccaacgccacatgctacaaggaccagggagtcacctacaggggcacatggagc
acagcggaaagcggggctgagtgcctcaactggaacagcagcgcactggccctgaagccg
tacaatgggcggaggcctgatgctgtcaggctgggccttgggaaccacaattactgcaga
aacccagaccgagactcgaagccctggtgctacatctttaaggaggggaagtacacctcc
gagttctgcagcacgccagcctgtgccaatgaaaaaaaagaggattgctactttggaaaa
gggttagattaccaggggacccacagcattaccacatctggtgccacctgccttcagtgg
gattctctgaccctgataggcaagatttacacagcatggaacagcaacgcccaggcactg
ggcctgggcaaacacaattactgccggaatccagatggtgatgccaagccctggtgccac
gtgctaaaggaccacaagctgacgtgggaatactgtgacgtgccccagtgctccacctgt
ggcctgagacagtacaagcagcctcagtttcgcattaaaggaggactctacacggacatc
acctctcatccctggcaggccgccatctttgtcaagaacaggaggtcaccaggagagagg
tttctatgtgggggaacactgatcaattcctgctgggtcctgtctgctgcccactgcttc
caggagaggtttccttcccaccatgttaaggtggtcttgggcaggacgtaccggttggtt
cctggagaggaggagcagaaatttgaagtcgaaaaatacatcgtccataaggaatttgat
gacgacacttacaacaatgacattgcactgttgcggctgaaatctgattcatcgtactgt
gctcaggagagcaacacggtgcgccctgtctgcctccctgaggccagcctgcagctgccc
gactggaccgaatgtgagctttctggctacggcaagcacgagtcgacttctccttcctat
tccgagcgcctgaaggaggctcatatccgactgtatccgtccagccgctgcacatcacag
catatgttcaataaaaccgtcacaaacaatatgttgtgtgccggagacacacgtagtgga
ggaagccaagtgaacctgcatgacgcctgccagggtgattcaggaggccctttggtgtgt
atgacggacaagcgcatgactttggttggcatcatcagttggggcattggctgtggacag
aaagatgttccgggtgtatataccaaggttgctaattacctagactggattcaagacaat
atgcgaccatga

DBGET integrated database retrieval system