KEGG   Loxodonta africana (African savanna elephant): 100658240
Entry
100658240         CDS       T04351                                 

Gene name
MAPK3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04114  Oocyte meiosis
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04350  TGF-beta signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04520  Adherens junction
lav04540  Gap junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav05010  Alzheimer disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05034  Alcoholism
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100658240 (MAPK3)
   04012 ErbB signaling pathway
    100658240 (MAPK3)
   04014 Ras signaling pathway
    100658240 (MAPK3)
   04015 Rap1 signaling pathway
    100658240 (MAPK3)
   04350 TGF-beta signaling pathway
    100658240 (MAPK3)
   04370 VEGF signaling pathway
    100658240 (MAPK3)
   04371 Apelin signaling pathway
    100658240 (MAPK3)
   04668 TNF signaling pathway
    100658240 (MAPK3)
   04066 HIF-1 signaling pathway
    100658240 (MAPK3)
   04068 FoxO signaling pathway
    100658240 (MAPK3)
   04072 Phospholipase D signaling pathway
    100658240 (MAPK3)
   04071 Sphingolipid signaling pathway
    100658240 (MAPK3)
   04024 cAMP signaling pathway
    100658240 (MAPK3)
   04022 cGMP-PKG signaling pathway
    100658240 (MAPK3)
   04151 PI3K-Akt signaling pathway
    100658240 (MAPK3)
   04150 mTOR signaling pathway
    100658240 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100658240 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100658240 (MAPK3)
   04210 Apoptosis
    100658240 (MAPK3)
   04218 Cellular senescence
    100658240 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100658240 (MAPK3)
   04520 Adherens junction
    100658240 (MAPK3)
   04540 Gap junction
    100658240 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100658240 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100658240 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100658240 (MAPK3)
   04613 Neutrophil extracellular trap formation
    100658240 (MAPK3)
   04620 Toll-like receptor signaling pathway
    100658240 (MAPK3)
   04621 NOD-like receptor signaling pathway
    100658240 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    100658240 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    100658240 (MAPK3)
   04660 T cell receptor signaling pathway
    100658240 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    100658240 (MAPK3)
   04659 Th17 cell differentiation
    100658240 (MAPK3)
   04657 IL-17 signaling pathway
    100658240 (MAPK3)
   04662 B cell receptor signaling pathway
    100658240 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    100658240 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    100658240 (MAPK3)
   04062 Chemokine signaling pathway
    100658240 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100658240 (MAPK3)
   04929 GnRH secretion
    100658240 (MAPK3)
   04912 GnRH signaling pathway
    100658240 (MAPK3)
   04915 Estrogen signaling pathway
    100658240 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    100658240 (MAPK3)
   04917 Prolactin signaling pathway
    100658240 (MAPK3)
   04921 Oxytocin signaling pathway
    100658240 (MAPK3)
   04926 Relaxin signaling pathway
    100658240 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    100658240 (MAPK3)
   04919 Thyroid hormone signaling pathway
    100658240 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    100658240 (MAPK3)
   04916 Melanogenesis
    100658240 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100658240 (MAPK3)
   04270 Vascular smooth muscle contraction
    100658240 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100658240 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100658240 (MAPK3)
   04725 Cholinergic synapse
    100658240 (MAPK3)
   04726 Serotonergic synapse
    100658240 (MAPK3)
   04720 Long-term potentiation
    100658240 (MAPK3)
   04730 Long-term depression
    100658240 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    100658240 (MAPK3)
   04722 Neurotrophin signaling pathway
    100658240 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    100658240 (MAPK3)
   04380 Osteoclast differentiation
    100658240 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100658240 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658240 (MAPK3)
   05206 MicroRNAs in cancer
    100658240 (MAPK3)
   05205 Proteoglycans in cancer
    100658240 (MAPK3)
   05203 Viral carcinogenesis
    100658240 (MAPK3)
   05230 Central carbon metabolism in cancer
    100658240 (MAPK3)
   05231 Choline metabolism in cancer
    100658240 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100658240 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100658240 (MAPK3)
   05212 Pancreatic cancer
    100658240 (MAPK3)
   05225 Hepatocellular carcinoma
    100658240 (MAPK3)
   05226 Gastric cancer
    100658240 (MAPK3)
   05214 Glioma
    100658240 (MAPK3)
   05216 Thyroid cancer
    100658240 (MAPK3)
   05221 Acute myeloid leukemia
    100658240 (MAPK3)
   05220 Chronic myeloid leukemia
    100658240 (MAPK3)
   05218 Melanoma
    100658240 (MAPK3)
   05211 Renal cell carcinoma
    100658240 (MAPK3)
   05219 Bladder cancer
    100658240 (MAPK3)
   05215 Prostate cancer
    100658240 (MAPK3)
   05213 Endometrial cancer
    100658240 (MAPK3)
   05224 Breast cancer
    100658240 (MAPK3)
   05223 Non-small cell lung cancer
    100658240 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100658240 (MAPK3)
   05020 Prion disease
    100658240 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100658240 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    100658240 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100658240 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100658240 (MAPK3)
   04934 Cushing syndrome
    100658240 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100658240 (MAPK3)
   05135 Yersinia infection
    100658240 (MAPK3)
   05133 Pertussis
    100658240 (MAPK3)
   05152 Tuberculosis
    100658240 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100658240 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    100658240 (MAPK3)
   05161 Hepatitis B
    100658240 (MAPK3)
   05160 Hepatitis C
    100658240 (MAPK3)
   05171 Coronavirus disease - COVID-19
    100658240 (MAPK3)
   05164 Influenza A
    100658240 (MAPK3)
   05163 Human cytomegalovirus infection
    100658240 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100658240 (MAPK3)
   05165 Human papillomavirus infection
    100658240 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100658240 (MAPK3)
   05140 Leishmaniasis
    100658240 (MAPK3)
   05142 Chagas disease
    100658240 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100658240 (MAPK3)
   01524 Platinum drug resistance
    100658240 (MAPK3)
   01522 Endocrine resistance
    100658240 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100658240 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100658240 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100658240 (MAPK3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100658240 (MAPK3)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100658240 (MAPK3)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100658240 (MAPK3)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100658240 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase FTA2 NDUF_B4 Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 100658240
NCBI-ProteinID: XP_010596797
LinkDB
Position
Unknown
AA seq 265 aa
MRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILSILGSPSQEDLNCIINMKARNYLQSLPAKTKVAWAK
LFPKSDPKALELLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDD
LPKERLKALIFQETARFQPEALEAT
NT seq 798 nt   +upstreamnt  +downstreamnt
atgcgggacgtctacattgtacaggacctgatggagacagacctatacaagttgctcaaa
agccagcagctgagcaatgaccatgtctgctacttcctctaccagatcctgcggggcctc
aaatatatccactctgccaatgtgctgcaccgagacctaaagccctccaacctgctcatc
aacaccacctgtgaccttaagatctgtgattttggcctggcccggattgccgatcctgag
cacgaccacaccgggttcttgacagagtacgtggctacacgctggtaccgggcaccagag
atcatgctcaactccaagggctataccaagtccatcgacatctggtctgtgggttgcatc
ctggctgagatgctctccaaccggcccatcttccctggcaagcactacctggaccagctc
aaccacattctgagtattctgggctccccatcccaggaagacctgaattgtatcatcaac
atgaaggcccgaaactacctacagtctctgcctgccaagaccaaggtggcctgggccaag
ctctttcccaagtcagaccccaaagcgcttgaactgctggaccggatgttgacctttaac
ccaaacaaacggatcacagtagaggaagcactggcccacccctacctggagcagtactat
gaccccacagatgagccggtggccgaggaacccttcacctttgacatggagctggatgat
ctacccaaggagcgactgaaggcactcatctttcaggagacagcccgcttccagcctgag
gcactagaagccacttaa

KEGG   Loxodonta africana (African savanna elephant): 100665157
Entry
100665157         CDS       T04351                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04114  Oocyte meiosis
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04350  TGF-beta signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04520  Adherens junction
lav04540  Gap junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav05010  Alzheimer disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05034  Alcoholism
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100665157 (MAPK1)
   04012 ErbB signaling pathway
    100665157 (MAPK1)
   04014 Ras signaling pathway
    100665157 (MAPK1)
   04015 Rap1 signaling pathway
    100665157 (MAPK1)
   04350 TGF-beta signaling pathway
    100665157 (MAPK1)
   04370 VEGF signaling pathway
    100665157 (MAPK1)
   04371 Apelin signaling pathway
    100665157 (MAPK1)
   04668 TNF signaling pathway
    100665157 (MAPK1)
   04066 HIF-1 signaling pathway
    100665157 (MAPK1)
   04068 FoxO signaling pathway
    100665157 (MAPK1)
   04072 Phospholipase D signaling pathway
    100665157 (MAPK1)
   04071 Sphingolipid signaling pathway
    100665157 (MAPK1)
   04024 cAMP signaling pathway
    100665157 (MAPK1)
   04022 cGMP-PKG signaling pathway
    100665157 (MAPK1)
   04151 PI3K-Akt signaling pathway
    100665157 (MAPK1)
   04150 mTOR signaling pathway
    100665157 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100665157 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100665157 (MAPK1)
   04210 Apoptosis
    100665157 (MAPK1)
   04218 Cellular senescence
    100665157 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100665157 (MAPK1)
   04520 Adherens junction
    100665157 (MAPK1)
   04540 Gap junction
    100665157 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100665157 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100665157 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100665157 (MAPK1)
   04613 Neutrophil extracellular trap formation
    100665157 (MAPK1)
   04620 Toll-like receptor signaling pathway
    100665157 (MAPK1)
   04621 NOD-like receptor signaling pathway
    100665157 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    100665157 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    100665157 (MAPK1)
   04660 T cell receptor signaling pathway
    100665157 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    100665157 (MAPK1)
   04659 Th17 cell differentiation
    100665157 (MAPK1)
   04657 IL-17 signaling pathway
    100665157 (MAPK1)
   04662 B cell receptor signaling pathway
    100665157 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    100665157 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    100665157 (MAPK1)
   04062 Chemokine signaling pathway
    100665157 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100665157 (MAPK1)
   04929 GnRH secretion
    100665157 (MAPK1)
   04912 GnRH signaling pathway
    100665157 (MAPK1)
   04915 Estrogen signaling pathway
    100665157 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    100665157 (MAPK1)
   04917 Prolactin signaling pathway
    100665157 (MAPK1)
   04921 Oxytocin signaling pathway
    100665157 (MAPK1)
   04926 Relaxin signaling pathway
    100665157 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    100665157 (MAPK1)
   04919 Thyroid hormone signaling pathway
    100665157 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    100665157 (MAPK1)
   04916 Melanogenesis
    100665157 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100665157 (MAPK1)
   04270 Vascular smooth muscle contraction
    100665157 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100665157 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100665157 (MAPK1)
   04725 Cholinergic synapse
    100665157 (MAPK1)
   04726 Serotonergic synapse
    100665157 (MAPK1)
   04720 Long-term potentiation
    100665157 (MAPK1)
   04730 Long-term depression
    100665157 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    100665157 (MAPK1)
   04722 Neurotrophin signaling pathway
    100665157 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    100665157 (MAPK1)
   04380 Osteoclast differentiation
    100665157 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100665157 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665157 (MAPK1)
   05206 MicroRNAs in cancer
    100665157 (MAPK1)
   05205 Proteoglycans in cancer
    100665157 (MAPK1)
   05203 Viral carcinogenesis
    100665157 (MAPK1)
   05230 Central carbon metabolism in cancer
    100665157 (MAPK1)
   05231 Choline metabolism in cancer
    100665157 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100665157 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100665157 (MAPK1)
   05212 Pancreatic cancer
    100665157 (MAPK1)
   05225 Hepatocellular carcinoma
    100665157 (MAPK1)
   05226 Gastric cancer
    100665157 (MAPK1)
   05214 Glioma
    100665157 (MAPK1)
   05216 Thyroid cancer
    100665157 (MAPK1)
   05221 Acute myeloid leukemia
    100665157 (MAPK1)
   05220 Chronic myeloid leukemia
    100665157 (MAPK1)
   05218 Melanoma
    100665157 (MAPK1)
   05211 Renal cell carcinoma
    100665157 (MAPK1)
   05219 Bladder cancer
    100665157 (MAPK1)
   05215 Prostate cancer
    100665157 (MAPK1)
   05213 Endometrial cancer
    100665157 (MAPK1)
   05224 Breast cancer
    100665157 (MAPK1)
   05223 Non-small cell lung cancer
    100665157 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100665157 (MAPK1)
   05020 Prion disease
    100665157 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    100665157 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    100665157 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100665157 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100665157 (MAPK1)
   04934 Cushing syndrome
    100665157 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100665157 (MAPK1)
   05135 Yersinia infection
    100665157 (MAPK1)
   05133 Pertussis
    100665157 (MAPK1)
   05152 Tuberculosis
    100665157 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100665157 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    100665157 (MAPK1)
   05161 Hepatitis B
    100665157 (MAPK1)
   05160 Hepatitis C
    100665157 (MAPK1)
   05171 Coronavirus disease - COVID-19
    100665157 (MAPK1)
   05164 Influenza A
    100665157 (MAPK1)
   05163 Human cytomegalovirus infection
    100665157 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100665157 (MAPK1)
   05165 Human papillomavirus infection
    100665157 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100665157 (MAPK1)
   05140 Leishmaniasis
    100665157 (MAPK1)
   05142 Chagas disease
    100665157 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100665157 (MAPK1)
   01524 Platinum drug resistance
    100665157 (MAPK1)
   01522 Endocrine resistance
    100665157 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100665157 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100665157 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100665157 (MAPK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100665157 (MAPK1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100665157 (MAPK1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100665157 (MAPK1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100665157 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase FTA2 Kdo Kinase-like
Other DBs
NCBI-GeneID: 100665157
NCBI-ProteinID: XP_010597195
LinkDB
Position
Unknown
AA seq 263 aa
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNR
LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaaggatgtatatatagtacaggacctcatggaaacagatctttacaagctcttgaag
acgcaacacctcagcaacgaccatatctgctattttctttaccagatcctcagaggatta
aaatatatccattcagctaatgttctgcaccgtgacctcaaaccttccaacctgctgctc
aacaccacctgtgatctcaagatctgcgactttggcttggcccgcgttgcagatccagac
catgatcacacgggcttcctgacggagtacgtagccacacgttggtacagggctccagaa
attatgttgaattccaagggctacaccaagtccattgatatctggtctgttggctgcatt
ctggcagagatgctctccaacaggcccatcttccctggaaagcactatcttgaccagctg
aaccatattctgggtattcttggatccccatcacaggaagacctgaattgtataataaat
ttaaaagctagaaactatttgctttctcttccacacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgattccaaagctctggacttactggataagatgttgactttcaac
cctcacaagaggattgaagtagaacaggctctggcccacccatatctggagcagtattac
gacccaagtgatgagcctattgctgaagcaccgttcaagtttgacatggaattggatgac
ttgcccaaggaaaaactcaaagaactcatttttgaagagactgcaagattccagccagga
tacagatcttaa

DBGET integrated database retrieval system