KEGG   Loxodonta africana (African savanna elephant): 100658419
Entry
100658419         CDS       T04351                                 

Gene name
GNAO1
Definition
(RefSeq) guanine nucleotide-binding protein G(o) subunit alpha
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav05032  Morphine addiction
lav05034  Alcoholism
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100658419 (GNAO1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100658419 (GNAO1)
   04921 Oxytocin signaling pathway
    100658419 (GNAO1)
   04926 Relaxin signaling pathway
    100658419 (GNAO1)
   04916 Melanogenesis
    100658419 (GNAO1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100658419 (GNAO1)
   04727 GABAergic synapse
    100658419 (GNAO1)
   04725 Cholinergic synapse
    100658419 (GNAO1)
   04728 Dopaminergic synapse
    100658419 (GNAO1)
   04726 Serotonergic synapse
    100658419 (GNAO1)
   04730 Long-term depression
    100658419 (GNAO1)
   04723 Retrograde endocannabinoid signaling
    100658419 (GNAO1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100658419 (GNAO1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100658419 (GNAO1)
   05034 Alcoholism
    100658419 (GNAO1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100658419 (GNAO1)
   05163 Human cytomegalovirus infection
    100658419 (GNAO1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100658419 (GNAO1)
   05142 Chagas disease
    100658419 (GNAO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100658419 (GNAO1)
   04031 GTP-binding proteins [BR:lav04031]
    100658419 (GNAO1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100658419 (GNAO1)
GTP-binding proteins [BR:lav04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100658419 (GNAO1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB DUF685 AAA_29 AAA_24
Other DBs
NCBI-GeneID: 100658419
NCBI-ProteinID: XP_003416356
UniProt: G3SQ78
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SPELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGASDYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggatgtactctgagtgcagaagagagagccgccctcgagcggagcaaggcgattgag
aaaaacctcaaagaggatggcatcagcgccgccaaagacgtgaaattactcctgctgggg
gctggagaatcaggaaaaagcacgattgtgaagcaaatgaagatcatccacgaagatggc
ttctctggagaagacgtgaaacagtacaagcctgttgtctacagcaacaccatccagtcc
ctggcagccattgttcgagccatggacactttgggcattgaatacggtgacaaggagaga
aaggccgacgccaagatggtgtgtgacgtggtgagtcggatggaagatactgagcctttc
tctccagagctgctttctgccatgatgcgactctggggcgactcaggaatccaggagtgc
ttcaaccggtctcgggagtatcagctcaatgattctgccaaatactacctggacagcctg
gatcggatcggggcctcggactaccagcccacagagcaggacatcctccgaaccagggtc
aaaaccaccggcatcgtagaaacccacttcacattcaagaacctccacttcaggctgttc
gacgttgggggccaacgatctgaacgtaagaagtggatccactgcttcgaggacgtcacg
gccatcatcttctgtgtcgcactcagcggctatgaccaggtgctccatgaagacgaaacc
acgaaccgcatgcacgagtctctcatgctctttgactccatctgcaacaacaagttcttc
atcgacacctccatcattctcttcctcaacaagaaggatctctttggcgagaagatcaag
aagtcacctttgaccatctgcttccctgaatacacaggccccaatacctatgaagatgca
gccgcctacatccaagcacaatttgaaagcaaaaaccgctcacccaacaaagaaatttat
tgtcacatgacttgtgccacagacacgaataatatccaggtggtattcgacgccgtcacc
gacatcatcattgccaacaacctccggggctgcggcttgtactga

KEGG   Loxodonta africana (African savanna elephant): 100666344
Entry
100666344         CDS       T04351                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04360  Axon guidance
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04670  Leukocyte transendothelial migration
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04921  Oxytocin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04971  Gastric acid secretion
lav05012  Parkinson disease
lav05030  Cocaine addiction
lav05032  Morphine addiction
lav05034  Alcoholism
lav05133  Pertussis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100666344 (GNAI1)
   04371 Apelin signaling pathway
    100666344 (GNAI1)
   04071 Sphingolipid signaling pathway
    100666344 (GNAI1)
   04024 cAMP signaling pathway
    100666344 (GNAI1)
   04022 cGMP-PKG signaling pathway
    100666344 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100666344 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100666344 (GNAI1)
   04670 Leukocyte transendothelial migration
    100666344 (GNAI1)
   04062 Chemokine signaling pathway
    100666344 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100666344 (GNAI1)
   04915 Estrogen signaling pathway
    100666344 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    100666344 (GNAI1)
   04921 Oxytocin signaling pathway
    100666344 (GNAI1)
   04926 Relaxin signaling pathway
    100666344 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    100666344 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    100666344 (GNAI1)
   04916 Melanogenesis
    100666344 (GNAI1)
   04924 Renin secretion
    100666344 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100666344 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    100666344 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100666344 (GNAI1)
   04727 GABAergic synapse
    100666344 (GNAI1)
   04725 Cholinergic synapse
    100666344 (GNAI1)
   04728 Dopaminergic synapse
    100666344 (GNAI1)
   04726 Serotonergic synapse
    100666344 (GNAI1)
   04730 Long-term depression
    100666344 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    100666344 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    100666344 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100666344 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100666344 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100666344 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    100666344 (GNAI1)
   05032 Morphine addiction
    100666344 (GNAI1)
   05034 Alcoholism
    100666344 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100666344 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100666344 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100666344 (GNAI1)
   05163 Human cytomegalovirus infection
    100666344 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100666344 (GNAI1)
   05142 Chagas disease
    100666344 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100666344 (GNAI1)
   04031 GTP-binding proteins [BR:lav04031]
    100666344 (GNAI1)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100666344 (GNAI1)
GTP-binding proteins [BR:lav04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100666344 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100666344
NCBI-ProteinID: XP_003407227
UniProt: G3TPI4
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgtacgctgagcgccgaggacaaggcggcggtggagaggagtaagatgatcgac
cggaacctccgcgaggatggcgagaaggcggcgcgcgaggtcaagctgctgctgctcggt
gctggtgaatctgggaaaagtacaattgtcaagcaaatgaaaatcatccacgaagctggc
tattcagaagaggaatgcaaacaatacaaagcagtggtctacagtaacaccatccagtca
attattgctatcattagggccatggggaggttgaagatagacttcggtgactcggctcgg
gcggacgacgcccgccaactctttgtgcttgctggtgctgctgaagagggttttatgact
gcagaacttgctggagttataaagagattgtggaaagatagtggggtacaagcctgtttc
aacagatcccgagagtaccagcttaatgattctgcagcgtactatttgaatgacttggac
agaatagcacaaccaaattatatcccaactcagcaagatgttctccgaactagagtgaaa
acaacagggattgttgaaacccattttactttcaaggatcttcattttaaaatgtttgat
gtgggaggacagagatctgagcggaagaagtggattcattgctttgaaggagtgactgcg
attatcttctgtgtagcacttagtgactatgacctggttctagctgaagatgaagaaatg
aatcgaatgcatgaaagcatgaagttgtttgacagcatatgtaacaacaaatggtttaca
gatacatctatcatactttttctaaacaagaaggatctcttcgaagaaaaaatcaaaaag
agccctcttactatatgctatccagagtatgcaggatcaaacacatatgaagaggcagct
gcatatattcaatgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatatac
acccacttcacatgtgccacagatactaagaatgtgcagtttgttttcgatgccgtaaca
gatgttatcataaaaaataacctaaaagattgtggcctcttctag

KEGG   Loxodonta africana (African savanna elephant): 100667957
Entry
100667957         CDS       T04351                                 

Gene name
GNAI3
Definition
(RefSeq) LOW QUALITY PROTEIN: guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04360  Axon guidance
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04670  Leukocyte transendothelial migration
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04921  Oxytocin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04971  Gastric acid secretion
lav05012  Parkinson disease
lav05030  Cocaine addiction
lav05032  Morphine addiction
lav05034  Alcoholism
lav05133  Pertussis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100667957 (GNAI3)
   04371 Apelin signaling pathway
    100667957 (GNAI3)
   04071 Sphingolipid signaling pathway
    100667957 (GNAI3)
   04024 cAMP signaling pathway
    100667957 (GNAI3)
   04022 cGMP-PKG signaling pathway
    100667957 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100667957 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100667957 (GNAI3)
   04670 Leukocyte transendothelial migration
    100667957 (GNAI3)
   04062 Chemokine signaling pathway
    100667957 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100667957 (GNAI3)
   04915 Estrogen signaling pathway
    100667957 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    100667957 (GNAI3)
   04921 Oxytocin signaling pathway
    100667957 (GNAI3)
   04926 Relaxin signaling pathway
    100667957 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    100667957 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    100667957 (GNAI3)
   04916 Melanogenesis
    100667957 (GNAI3)
   04924 Renin secretion
    100667957 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100667957 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    100667957 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100667957 (GNAI3)
   04727 GABAergic synapse
    100667957 (GNAI3)
   04725 Cholinergic synapse
    100667957 (GNAI3)
   04728 Dopaminergic synapse
    100667957 (GNAI3)
   04726 Serotonergic synapse
    100667957 (GNAI3)
   04730 Long-term depression
    100667957 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    100667957 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    100667957 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100667957 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100667957 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100667957 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    100667957 (GNAI3)
   05032 Morphine addiction
    100667957 (GNAI3)
   05034 Alcoholism
    100667957 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100667957 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100667957 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100667957 (GNAI3)
   05163 Human cytomegalovirus infection
    100667957 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100667957 (GNAI3)
   05142 Chagas disease
    100667957 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100667957 (GNAI3)
   04031 GTP-binding proteins [BR:lav04031]
    100667957 (GNAI3)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100667957 (GNAI3)
GTP-binding proteins [BR:lav04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100667957 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100667957
NCBI-ProteinID: XP_010587845
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSXTIQSIIAIIRAWDGSRLTLEEAARADDARQLFVLAGSAEEGIMT
LELAGVIKRLWRDEGVQACFSRSREYQLNDSASYYLNDLDRISQINYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggggagaaggcggccaaggaagtaaagctgctcctgcttggt
gctggagaatctgggaaaagcaccatcgtgaagcagatgaaaatcattcatgaggatggc
tattcagaggaagaatgcaaacagtataaagtagttgtctacagcnatactatacagtcc
atcattgcaatcataagagcatgggacggctcaagattgactttggaggaagctgccaga
gcagatgatgcccggcaattgtttgttttagctggcagtgctgaagaaggaatcatgact
ctagaactagcaggagtgattaaacggttatggcgagatgagggggtgcaagcttgcttc
agcagatccagggaatatcaactcaatgattctgcttcgtattacctaaatgatttggat
agaatatcccaaatcaactatattccaactcagcaagatgtccttcgaacaagagtgaag
accactggcatcgtggaaacgcatttcaccttcaaggacctatacttcaagatgtttgat
gtaggtggtcaaagatcagaacgaaaaaaatggattcactgttttgagggagtcacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggatgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagtatttgtaacaacaaatggtttaca
gacacttcaatcattctcttcctcaacaagaaagacctttttgaggaaaaaataaggagg
agtccattaactatctgttatccagaatacacaggttccaatacatatgaagaggcagct
gcttacattcagtgccagtttgaagatctgaacagaagaaaagataccaaggagatctac
actcatttcacctgtgccacagacacaaagaatgtgcagtttgtttttgatgctgttacg
gatgttatcattaaaaacaatttgaaggaatgtggactttattga

KEGG   Loxodonta africana (African savanna elephant): 100670234
Entry
100670234         CDS       T04351                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04360  Axon guidance
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04670  Leukocyte transendothelial migration
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04921  Oxytocin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04971  Gastric acid secretion
lav05012  Parkinson disease
lav05030  Cocaine addiction
lav05032  Morphine addiction
lav05034  Alcoholism
lav05133  Pertussis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100670234 (GNAI2)
   04371 Apelin signaling pathway
    100670234 (GNAI2)
   04071 Sphingolipid signaling pathway
    100670234 (GNAI2)
   04024 cAMP signaling pathway
    100670234 (GNAI2)
   04022 cGMP-PKG signaling pathway
    100670234 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100670234 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100670234 (GNAI2)
   04670 Leukocyte transendothelial migration
    100670234 (GNAI2)
   04062 Chemokine signaling pathway
    100670234 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100670234 (GNAI2)
   04915 Estrogen signaling pathway
    100670234 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    100670234 (GNAI2)
   04921 Oxytocin signaling pathway
    100670234 (GNAI2)
   04926 Relaxin signaling pathway
    100670234 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    100670234 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    100670234 (GNAI2)
   04916 Melanogenesis
    100670234 (GNAI2)
   04924 Renin secretion
    100670234 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100670234 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    100670234 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100670234 (GNAI2)
   04727 GABAergic synapse
    100670234 (GNAI2)
   04725 Cholinergic synapse
    100670234 (GNAI2)
   04728 Dopaminergic synapse
    100670234 (GNAI2)
   04726 Serotonergic synapse
    100670234 (GNAI2)
   04730 Long-term depression
    100670234 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    100670234 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    100670234 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100670234 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670234 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100670234 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    100670234 (GNAI2)
   05032 Morphine addiction
    100670234 (GNAI2)
   05034 Alcoholism
    100670234 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100670234 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100670234 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100670234 (GNAI2)
   05163 Human cytomegalovirus infection
    100670234 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100670234 (GNAI2)
   05142 Chagas disease
    100670234 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100670234 (GNAI2)
   04031 GTP-binding proteins [BR:lav04031]
    100670234 (GNAI2)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100670234 (GNAI2)
GTP-binding proteins [BR:lav04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100670234 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Other DBs
NCBI-GeneID: 100670234
NCBI-ProteinID: XP_003410144
LinkDB
Position
Unknown
AA seq 354 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKARGVKLLLLGAGESGKSTIVKQMKIIHEDGY
SEEECRQYRAVVYSNTIQSIMAIVKAMNNLQINFSDSSREDDARQLFALSCTAEEQGVLP
EDLSSVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEAA
SYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcggccgagcgctccaagatgatcgac
aagaatctgcgggaagacggcgagaaggcgcgcggagtgaagttgctgctgctgggtgct
ggggagtcagggaagagcaccattgtcaagcagatgaagatcatccatgaggatggctac
tcagaggaggaatgccggcagtaccgggcagtggtctacagcaacaccattcagtctatc
atggccatcgtcaaggccatgaacaacctgcagattaacttttctgactcctcccgagag
gacgatgccaggcagctgtttgcactgtcttgcacggctgaggagcagggcgtgcttcca
gaggacctgtccagcgtcatccggaggctctgggctgaccatggtgtacaggcctgcttt
ggccgctcaagggagtaccagctcaatgattcagctgcctactacctgaacgacctggag
cgcatcgcacagagtgactatatccccacgcagcaggacgtgctgcggacccgtgtgaag
accacgggcatcgtggagacacacttcaccttcaaggacctgcacttcaagatgtttgat
gtgggtggtcagcggtctgagcggaaaaagtggatccactgctttgagggcgtcacagcg
atcatcttctgtgtagccttgagcgcctatgacctggtgctggctgaggatgaggagatg
aaccgcatgcatgaaagcatgaagctgtttgacagcatctgcaacaacaagtggttcacg
gacacgtccatcatcctcttcctcaacaagaaggacctgttcgaggagaagatcacacac
agccccctgaccatctgcttccctgaatacacaggggccaacaagtacgacgaggcagcc
agctatatccagagcaagtttgaggacctgaacaagcgcaaggacaccaaggagatctac
acacacttcacgtgtgccaccgacaccaagaacgtgcagtttgtgtttgatgccgtcacc
gacgtcatcatcaagaacaacctgaaggactgcggcctcttctga

DBGET integrated database retrieval system