KEGG   Loxodonta africana (African savanna elephant): 100658501
Entry
100658501         CDS       T04351                                 

Gene name
PDE8A
Definition
(RefSeq) high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A isoform X3
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100658501 (PDE8A)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100658501 (PDE8A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100658501 (PDE8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100658501 (PDE8A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100658501 (PDE8A)
SSDB
Motif
Pfam: PDEase_I PAS_9 PAS PAS_3 PAS_4 UBA_e1_thiolCys
Other DBs
NCBI-GeneID: 100658501
NCBI-ProteinID: XP_010592101
LinkDB
Position
Unknown
AA seq 687 aa
MRFHQDQLQVLLVFTKEDSQCNGFYKACEKTGFKCTVTKEPQAVLACFLDKHHDIIIIDH
RHPRQLDADALCRSIRSSKLSENTVIIGVVRRGDREESSVMPLVAAGFTRRYVENPSVMA
CYNELIQLEYGEVRSQLKLRACNSVFTALEKSQEAIEITSEDHIIQYANPAFETTMGYQS
GELIGKELAEVPINEKKADLLNTINSYIRIGKEWQGIYCTKKKNGDNIQQNVKIIPVIGQ
GGKIRHYVSIIRVCNGNNKAEKIAECVQPDSLTDVQTGKLIKDRRKDSLDVRSLSTRSSE
VASQRRHSSLARIHSMTIDAPITKVINIINAAQESSPVPVTEALDRVLEILRTTELYSPQ
FGAKDDDPHANDLVGGLMCDGLRRLSGNDYVLSPKNLHQVSSRIINSISLHDIPPRIARI
MENEEFWDFDIFELEAATHKRPLIYLGLKIFARFGICEFLNCSESTLKSWLQVIETNYHS
SNPYHNSTHAADVLHATAYFLSKERIKQTLDPVDEVAALLAATIHDVDHPGRTNSFLCNA
GSELAILYNDTAVLESHHAALGFQLTIRDDKCNIFKNMERNDYRMLRQGIIDMVLATEMT
KHFEHVNKFVNSINKPLALLEENRETDKDQEAVNTMLRTPENRTLIKRMLIKCADVSNPC
RSLEFCIEWAARISEEYFSQPLLTCRI
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgagatttcatcaagatcaacttcaggtacttttagtgtttaccaaagaagatagccag
tgtaacggattctataaggcatgtgaaaagacagggtttaagtgtacagtcaccaaggag
cctcaggcagtgcttgcctgcttcctggacaaacaccatgacatcatcatcatagaccac
agacatccccgccagctggatgcagatgcactgtgcaggtctatcagatcgtcaaaactc
tcagagaacacagttattattggtgttgtacgcaggggggatagagaagagtcatctgta
atgcccctcgttgctgctggttttacaaggaggtatgtagaaaaccccagtgtcatggcc
tgttacaatgagctgatccagctggagtatggagaagtgcgatcccaactgaaactcagg
gcttgtaactcagtattcactgcactagagaaaagtcaagaagcaattgaaattacaagt
gaagaccacattatacagtatgcaaatcctgcatttgaaacaacaatgggctatcagtca
ggtgaattaatagggaaggagttagctgaagtgcctataaatgaaaaaaaggctgacttg
ctcaatactataaattcatatatcaggattggcaaggagtggcaaggaatttattgcacc
aaaaagaaaaacggagataatattcaacaaaatgtgaagataatacctgtcattggacag
ggaggaaaaattagacactatgtgtccattatcagagtgtgcaatggcaacaataaggct
gagaaaatagctgaatgtgttcagcctgacagtcttacagatgtgcagacaggcaaactt
attaaagacaggagaaaagactcgctagatgtcagatctctttccactcgatcaagtgaa
gttgccagccagagacgacactcctccttggcccggatacattccatgacgatcgatgca
cccatcaccaaggtaatcaatattatcaatgctgcccaagaaagcagtcccgtgcctgtg
acagaagccttagaccgtgtgctggaaattttaagaaccactgaattatattcaccacag
tttggtgctaaggacgacgatcctcatgccaacgacctggttgggggcttaatgtgtgat
ggtttgcgaagactatcagggaatgactatgttctttcaccaaagaaccttcaccaggtt
tcaagcagaataatcaattccatctcccttcatgacattccaccacggatagctcgaatc
atggaaaatgaggaattctgggactttgatatttttgaactggaggctgccacccacaag
aggcctttgatttatcttggtctcaaaatatttgctcgatttggaatctgtgagttctta
aactgctctgagtcaacgctcaagtcgtggttacaagttatcgaaaccaattatcattct
tctaacccttaccacaactctacacatgctgctgatgtgctgcacgcaacagcgtatttc
ctgtccaaagaaaggataaagcaaactttagatccagttgacgaggtcgctgcccttctt
gcagccactattcacgacgtggatcatcctgggagaaccaactctttcttgtgtaatgct
ggaagcgagctggccattttgtacaatgacactgctgtcctggagagccaccatgcagcc
ctgggcttccagctgaccatccgggatgataaatgcaatatttttaaaaacatggagagg
aatgactatcggatgctgcgccagggtattattgacatggtcctagctacagaaatgaca
aagcacttcgagcacgtcaacaagtttgtcaacagtatcaacaagcccttggcattacta
gaagaaaacagggaaactgataaagatcaggaagcagtaaacactatgctcaggacacca
gagaaccgaactctgatcaaacgaatgctgattaagtgtgctgatgtgtccaatccctgt
cgatccctggagttctgcatcgagtgggctgcacgtatctctgaagaatatttttctcag
cctttgttgacctgccggatttaa

KEGG   Loxodonta africana (African savanna elephant): 100670699
Entry
100670699         CDS       T04351                                 

Gene name
PDE8B
Definition
(RefSeq) high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100670699 (PDE8B)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100670699 (PDE8B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100670699 (PDE8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100670699 (PDE8B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100670699 (PDE8B)
SSDB
Motif
Pfam: PDEase_I PAS_9 PAS PAS_3 PAS_4 PAS_8
Other DBs
NCBI-GeneID: 100670699
NCBI-ProteinID: XP_010586531
LinkDB
Position
Unknown
AA seq 761 aa
MRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNISRTPESALECFLDKHHEIIVIDH
RQTRNFDAEAVCRSIRATNPSEHTVILAVVSQASGDHEEASVLPLLHAGFNRRYMENSSI
IACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGY
HKGELLGKELAELPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPV
IGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTESHSFRHKNRRKESIDVKSIS
SRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRT
TELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITINDVP
PCIAQLLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWLQVI
EANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTN
SFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDSKCNIFKNIDRNHYRTLRQAIIDMV
LATEMTKHFEHVNKFVNSINKPIAAEIEGSDCECNPVGKNFPENQMLIKRMMIKCADVAN
PCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDM
FDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDN
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgagactgacacaggaccctatccaggttttgctgatctttgcgaaggaagatagtcag
agtgacggattctggtgggcctgtgacagagccggctacaggtgcaatatctctcggact
ccggagtcagcccttgagtgctttttagataagcaccatgaaattatcgttattgatcac
aggcaaactcgaaactttgatgcagaagctgtgtgcaggtcaatccgggccacaaatccc
tccgagcacacggtgatccttgcggtggtttcacaagcatcgggtgaccatgaagaggcc
tctgtccttccacttctccatgctggcttcaacaggagatatatggagaatagcagcata
attgcttgctataatgaactgattcaaatagaacatggggaagttcgctcacagttcaaa
ctacgggcctgtaattcagtgtttacagcattagaccactgtcatgaagccatagaaata
acaagcgatgaccatgtgatccagtatgtcaaccccgcctttgaaaggatgatgggctac
cacaaaggtgagctcctggggaaagaacttgccgagctgcccaaaagtgacaagaaccgg
gcagaccttctcgacaccatcaacacatgcatcaagaagggaaaggagtggcagggggtt
tactatgccagacggaaatccggagacagcatccaacagcatgtgaagatcacgccagtg
attggccaaggagggaaaattaggcattttgtctccctcaagaaactgtgttgtaccacg
gacaataataagcagattcacaagattcatcgtgattcaggagacaattctcagacagag
tctcattcattcagacacaagaacaggaggaaagagtccattgatgtgaaatcgatatct
tctcgaggcagcgatgcaccaagcctacagaaccgtcgctatccatccatggcaaggatc
cactccatgaccatcgaggctcccatcacaaaggtcataaatataatcaatgcagcccaa
gaaaacagccctgtcacagtagcagaagccttggatagggttttagaaattttacggacc
acagagctgtactcccctcagctgggtaccaaagatgaagatcctcacaccagtgatcta
gtcggaggcctgatgactgatggcttaagaaggttgtcaggaaatgagtatgtgtttact
aagaacgtgcaccagagtcacagtcaccttgcgatgccaataaccatcaacgatgttccc
ccttgtattgctcaattacttgataatgaggaaagttgggacttcaacatctttgaattg
gaagctgttacacataaaaggccattggtttacctgggcttgaaggtcttttcccggttt
ggagtatgtgaatttttgaactgttctgaaaccactcttcgggcttggctgcaagtgatt
gaagccaactaccactcctccaatgcctaccataactccactcatgccgccgatgtcctg
catgccactgctttcttccttggaaaggaaagagtaaagggaagcctagatcagctggat
gaggtggcagcactgattgctgccacagtccatgatgtggatcacccaggaaggaccaat
tccttcctctgcaatgcaggcagtgaactcgctgtgctctacaatgacactgctgtcttg
gagagtcaccacacagccctggccttccagctgacagtcaaggacagcaagtgcaacatt
ttcaagaatattgacaggaaccactatcgaacactgcgccaggctattattgacatggtc
ttagcaacggagatgacaaaacactttgaacatgtgaacaaatttgtgaatagtatcaac
aaaccaatagccgctgagattgagggcagtgactgtgaatgcaaccctgttgggaagaac
tttcctgaaaaccaaatgctgatcaagcggatgatgattaagtgtgctgatgtggccaac
ccatgccgccccttggacctgtgcattgaatgggccgggcggatctcagaggagtatttt
gcacagactgatgaagagaagagacaggggctacctgtggtgatgccagtgtttgaccgg
aacacctgtagcatccctaagtcccagatttccttcattgattacttcataacagacatg
tttgatgcttgggatgcctttgcacatctgccagccctgatgcaacatttggctgataac
tacaaacactggaagacattggatgacctaaagtgcaaaagtctgaggcttccatctgac
aactaa

DBGET integrated database retrieval system