KEGG   Loxodonta africana (African savanna elephant): 100658588
Entry
100658588         CDS       T04351                                 

Gene name
PPM1D
Definition
(RefSeq) protein phosphatase 1D isoform X1
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100658588 (PPM1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100658588 (PPM1D)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100658588 (PPM1D)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    100658588 (PPM1D)
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 100658588
NCBI-ProteinID: XP_003414415
LinkDB
Position
Unknown
AA seq 607 aa
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSPSQPSPPQPSPPPPAL
PGSEVSGKGPAVAAREARGPPPDAGASPDPSRCCRRRSSVAFFAVCDGHGGREAAQFARE
HLWSFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVV
IIRGMKMYVAHVGDSGVVFGVQDDPKDDFIRAVEVTQDHKPELPKERERIEGLGGSVMNK
SGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSV
HTLDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKCLMGEHGQSCAKMLVNRALGRW
RQRMLRADNTSAIVICISPGADLQGSFANEDELYLNLTDSPFYNSQETCVMTPSPCSTPP
VKSLEEDPWPRLNSKDHIPALVRSNAFSENSLEIPAEIARGNVQAVVIPSKDPEPLEENC
TKALTLRIHDSLNNSLSVGLVPTNSTNTIMDQKNLKMSTPGQMKAQEVERTPPANFKRTL
EESNSGPLMKKHKRNSLSRSSGAQSASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQH
RKTVCVY
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggcggggctgtactcgctgggagtgagcgtcttctccgaccagggcgggaggaagtac
atggaggacgttactcaaatcgttgtggagcccgagccgacggccgaagaaaagccctcg
ccgcggcggtcgccctctcagccgtcgcctccgcagccgtcaccaccgccgccggctctc
cctggcagcgaagtctcggggaaaggcccggcagtggcagcccgagaagcccgcggtcct
cccccggacgccggcgcttcgccggatcccagccgctgctgccgccgccgttcctccgtt
gcatttttcgcagtgtgcgacgggcacggcgggcgggaggcggcacagtttgcccgggag
catttgtggagtttcatcaagaaacagaagggtttcacctcgtccgagccggcgaaggtt
tgcgctgccatccgcaaaggcttcctcgcctgtcacctcgccatgtggaagaaactggca
gaatggcccaagactatgacaggtcttcccagcacgtcagggacaactgccagcgtggtc
atcatacggggcatgaagatgtatgtagctcatgtgggagactcaggggtggtttttgga
gttcaggatgacccaaaggatgattttatcagagctgtggaggtgacacaggaccataag
ccagaacttcccaaggaaagagagcgaatcgaaggacttggtgggagtgtgatgaacaag
tctggagtgaatcgtgtagtttggaaacgacctcgactcactcacaatggacctgtacga
aggagcacagttattgaccaaatcccttttctggcagtagcaagagcacttggtgatttg
tggagctatgatttctttagcggtgagtttgttgtgtcacctgaaccagacacaagcgtc
cacactcttgacccccagaagcacaagtatattatcttgggtagtgatggactctggaat
atgattccacctcaagatgccatctcaatgtgccaggaccaagaggagaaaaaatgcttg
atgggtgagcacggacaatcttgtgccaaaatgctagtgaatcgagccctaggccggtgg
aggcagcgtatgctccgagcagataatactagtgccatagtaatctgcatctctccagga
gcggacctccagggcagctttgccaatgaagatgagctgtatctgaacctgactgatagt
cctttctataatagtcaagaaacctgtgtgatgactccttccccctgttctacaccacca
gtcaagtcactggaggaggatccatggccaagactgaactctaaggaccatatacctgct
cttgttcgtagtaatgccttctcagagaattctttagagatcccagctgagatagctcga
gggaatgtccaggctgtagtcataccctcaaaagatccagagccacttgaggaaaattgc
actaaagccctgactttaaggatacatgattccttgaataatagtctgtcagttggcctt
gtgcctacaaattcaacaaacactatcatggaccaaaaaaacttaaagatgtcaactcct
ggtcaaatgaaagcccaagaagtggaaagaacccctccagcaaactttaaaaggacattg
gaagaatccaactctggcccccttatgaagaagcataaacgaaatagtttgagtcgaagt
agcggtgctcagtctgcaagcctccccacaacctcgcagcgaaagaactctgttaaactt
accatgcgacgcagacttaggggtcagaagaaaattggaaatcccttactacatcagcac
cgaaaaactgtttgtgtttactga

DBGET integrated database retrieval system