KEGG   Loxodonta africana (African savanna elephant): 100658734
Entry
100658734         CDS       T04351                                 

Gene name
LRP6
Definition
(RefSeq) LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05200  Pathways in cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100658734 (LRP6)
   04150 mTOR signaling pathway
    100658734 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100658734 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658734 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100658734 (LRP6)
   05226 Gastric cancer
    100658734 (LRP6)
   05224 Breast cancer
    100658734 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100658734 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    100658734 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100658734 (LRP6)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100658734 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 100658734
NCBI-ProteinID: XP_010593283
UniProt: G3THM2
LinkDB
Position
Unknown
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTE
IYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGKGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDFVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNTDNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQSFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMMGREGRTKVQARIAQLSDIHAVKELNLH
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLAYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSMATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagtttctgtgtgctcctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacaaatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagccgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtaagcgaagaagccattaagcgaacagagttt
aacaaaactgagagtgtacagaatgttgttgtctccggattattatcccctgatgggctg
gcatgcgattggcttggagaaaaattgtactggacagattctgaaactaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaacct
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagaacgtgctggaatggatggttcaagccgcttcgttataataaacactgaa
atttactggccaaatggactaactttagattacgaggaacggaagctttattgggcagat
gcaaaacttaatttcatccataaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttgtttgaggacacattgtactggact
gactggaatacacactccattttggcttgcaacaagtacactggcaagggcctgcgtgaa
atccattctaacatcttctctcccatggatatacatgccttcagccaacagaggcagcca
aatgctacaaatccatgtggaattgataacggtggttgttcccacttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgtccaactggggtcaaactcctggagaatgga
aaaacctgcaaagatggtgccactgaattactgcttttagccagaaggacagacttgaga
cgcatttctttggatacaccagattttacagacatcgttctgcagttagaagacatccgt
catgccattgccatagattatgatcctgtggaaggctatatctattggaccgatgatgaa
gtgagggccatacgccgctctttcatagatggatcaggcagtcagtttgtggtcactgcc
caaattgcgcatcctgatggtattgctgtagactgggttgcacgaaatctttattggaca
gacactggcactgatcggatagaagtaacaaggctcaatgggaccatgaggaagatcttg
atttcagaagacttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tactggactgactggggagaaatcccgaaaattgagcgagcagctctggatggttctgac
cgagtcgtgttggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagataaaattgaggttatgaatactgat
ggcactggaagacgagtacttgtggaagacaaaattcctcacatatttgggtttactttg
ttgggtgactttgtttactggactgactggcagagacggagcatcgaaagagtacacaaa
cgaagtgctgagagggaaatcatcatagatcagctgcctgacctcatgggcctaaaggcc
acaaacgttcatcgaatcatcggttccaatccctgtgctgaggaaaatgggggatgtagt
catctttgcctctatagaccccagggcctacgctgtgcctgccccattggttttgaactc
atcagtgacatgaagacctgtattgtcccagaggctttccttttgttttcacggagagca
gatatcaggcgaatttctttggaaactaacaacaataatgtggccattcctctcactggt
gtcaaagaagcttccgctttggattttgatgtgacagacaaccgaatttactggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcactggaacatgtggta
gaattcggcttagattatccagaaggcatggcagtagactggcttgggaagaacttgtac
tgggcagacacgggaacaaatagaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtgtggaaagacctagatagtcccagagctcttgcattggaccctgctgaagga
tttatgtattggactgaatggggtggaaaacctaagatagacagagctgctatggatgga
agtgaacgtactacattagttccaaatgtggggcgggcaaacggcctaactattgattat
gctaaaagaaggctttattggacagacctggataccaacttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgatttgcctcatccatttggcttaactcaa
taccaggattacatctactggacggactggagccgacgcagcattgagcgtgccaacaaa
accagtggccaaaaccgcaccatcattcagggccatttggactatgtgatggacatcctg
gtctttcactcctctcggcaggcaggatggaatgagtgtgcctccagcaatgggcactgc
tcccatctctgcttggctgtaccagttggaggttttgtttgtggatgcccagcccactac
tctcttaatactgacaacagaacttgtagtgctcctaccactttcctgctcttcagtcaa
aagagtgccatcaaccggatggtgattgatgaacaacagagccctgacatcatccttcct
atccatagccttcggaatgtccgggccatcgactatgacccgctggacaagcaactctat
tggattgactcacgacaaaacatgattcgaaaggcccaagaagatggcagccagagcttt
actgtggttgtgagctcagttcccaatcagaacctagaaatacagccctatgacctcagc
attgatatttatagccgctacatctactggacttgtgaggccactaatgtcattaatgtc
acaagattagatggtcgatccattggagtggtgctgaaaggagagcaagacagacctcga
gccattgtggtaaacccagagaaagggtatatgtattttaccaaccttcaggaaaggtct
cccaaaattgaacgagctgctttggatggaacagaacgggaggtcctctttttcagtggc
ttaagtaaaccaattgctttagcccttgatagcagattgggcaagctcttttgggctgat
tcagatctccggcgaatcgaaagcagcgatctctcaggtgccaaccggatagtactggaa
gactctaatatcttgcagcctgtgggactgactgtatttgaaaattggctatattggatt
gataagcaacagcaaatgattgaaaaaattgacatgatgggtcgagagggtagaaccaaa
gtccaggctcgcattgcccagcttagtgacattcatgcagtaaaggagctgaatcttcac
gaatacaggcagcatccttgtgctcaggataatggtggctgttcacatatttgccttgtg
aaaggggatggtactacaaggtgctcttgtcccatgcacctggttctgcttcaagatgag
ctatcatgtggagaacctccgacatgctctcctcagcaatttacttgtttcacgggggaa
attgactgtatccctgtggcttggcggtgtgatggttttactgaatgtgaagaccacagt
gatgagctcaattgtcctgtctgctctgagtctcagttccagtgtgccagtgggcagtgt
attgatggtgccctccgatgcaatggagatgcaaactgccaggataaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgttgtgccaatggtcagtgcattgga
aaacacaagaaatgtgatcataatgtggattgcagtgacaaatcagatgaactggattgt
tatccaactgaggagccagcaccacaggccaccaatacagttggatcggttattggagtg
attgtcaccatttttgtgtctggaacggtatacttcatttgccagaggatgctgtgtcca
cgtatgaagggagatggggaaaccatgactaatgactatgtagttcatggaccagcttct
gtgccgcttgcttatgtgccacacccaagctctttgtcaggatctcttccaggaatgtct
cgaggaaaatcaatgatcagctccctcagtatcatgggtggaagcagtggacccccctat
gaccgagctcatgtcacaggagcatcctcaagtagttcttcaagcaccaagggcacttac
ttccctgcaattttgaaccctccaccatccccagccacagagcgatcccattatacaatg
gaatttggttattcttcaaacagcccttccactcacaggtcatacagctacaggccatac
agttaccggcactttgcacctcccacgaccccatgcagcacagatgtttgtgacagtgac
tatgctcccagccggagaatgacgtcgatggcaacagccaagggttacactagtgacttg
aactatgactcagagcctgtgcccccacctcccacacctcgaagccaatacttgtcagca
gaagagaactatgaaagctgcccaccttctccatacacagagaggagctactctcatcac
ctctacccaccgccaccctctccctgtacagactcctcctga

KEGG   Loxodonta africana (African savanna elephant): 100666209
Entry
100666209         CDS       T04351                                 

Gene name
LRP5
Definition
(RefSeq) LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05200  Pathways in cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100666209 (LRP5)
   04150 mTOR signaling pathway
    100666209 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100666209 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100666209 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100666209 (LRP5)
   05226 Gastric cancer
    100666209 (LRP5)
   05224 Breast cancer
    100666209 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100666209 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    100666209 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100666209 (LRP5)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100666209 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b Ldl_recept_a FXa_inhibition DUF5050 SGL EGF Insulin_TMD
Other DBs
NCBI-GeneID: 100666209
NCBI-ProteinID: XP_023415502
LinkDB
Position
Unknown
AA seq 2283 aa
MAAPPACESHWGCSEKVLRPAREVLACCAAPFDVAVFPSGLPPARCPSGRPVGPKRWRPA
QLTDVPPPGAGGVGPPSRVSGRSHQRNVRVSRCAHLWRDRELGNFLPDFQCRLYQLRRGE
GATQAEAAPLVQPQGHRRVLWGKPVPQPGGGNPDSSLDGDNDECVRLRACGTGRVVCGCG
LQRALSLVTPNIPYYSLDLPWASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVD
FQFSKGAVYWTDVSEEAIKQTFLNQTGAAVQNVIISGLVSPDGLACDWVGKKLYWTDSET
NRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKII
VDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGET
LYWTDWQTRSIHACNKRTGGEEEEILSALYSPMDIHDGFNMMVLVPGVLGHQPARAGFLH
TSGLCCLVVNDLRVELSPQTPVGSNRRISSQPCPSGRKRSQARAGSQEVLTVQSLASHFG
QMKASSVEGLDPPREGGGVVMMLESSEREVPRGGPSWVGCDHTRPPLPSQGLPGLGVNRR
WPSGLLPPPPLRAASHPAAHSWLWVWSPRPPNHEPCRGSLANRLQAPACLARVAPVPLIL
AGFGDGSGSLAPLSKPLCGADASAGCSCFQKAAVPAHTGAWGAGARGQLLGPQLVNGASP
RFGPFLCACDLVVIWRGFLDRRDGLWPQGLSNGLPQGTVEKLNRWLKNECRPASCRPRSH
LVRLFMPLNAQSTDGLHWDGPGREGPQCLSGRSAGAPGAGGDSRAGDRARGPLRVGFVLG
PHVSARAFLGLESGRRCEAVRSTQPIHSSKGGREDILEEELGSGHPVQEAICCPRAQFSR
AQQSRGLEAWPGMWSRALEVACGPDLLSSGVLETRKGLKKGADDETALQRSYHPSPARES
LILCSMSVRAVDEEWLCRGSLVNVAEQCLLSPSLPCLSGPLTTAPVSPGAEEVLLLARRT
DLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTL
VSTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLEEPRAIVLHPMM
GLMYWTDWGENPKIECAHLDGQERHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVI
SVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERAHKVKANRDVIIDQLPDLMG
LKAVNVAKVIGTNPCADRNGGCSHLCFFTPHATKCGCPIGLELLSDLKTCIVPEAFLVFT
SRAAIHRISLETTNNDVAIPLTGVKEASALDFDMSSNHIYWTDVSLKTISRAFMNGSSVE
HVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDP
TKGYIYWTEWGGKPRIVRAFMDGTSCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIES
SNMLGQERIVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTNGRNRTLIQGHLDFVM
DILVFHSSRQDGLNDCVQNNGQCGQLCLAVPGGHRCSCASHYTLDPSSRNCSPPTAFLLF
SQKCSISRVIPDDPHSPDLILPLHGLRNVKAVDYDPLDKLMYWVDGRQNIKRAKDDGTQP
YVLTSPGQSSDRQPHDLSIDVYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAI
TVNAERGYLYFTNMQDRTAKIERAALDGTEREVLFTTGLIRPVALVVDNRLGKLFWVDAD
LKRIESCDLSGANRLTLEDANIVQPVGLAVLGSHLYWADRQQQMIERVEKITGYQRTRVQ
GRIAHLTGIHAVEEVSTEEFLAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLT
CGEPPTCSPDQFACATGEIDCIPAAWRCDGFPECDDQSDEDGCPVCSAAQFPCERGQCVD
LRLRCDGEADCQDRSDEADCDAICLPSQFRCASGQCVLIKQQCDSFPDCMDGSDELMCEI
TKPPADDTLTHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPH
VPLNFIAPGGAQHGPFTGISCSKSMMNSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKAT
LYPPILNPPPSPATDPSLYNMDTFYSSNIPASTRPYRPYIIRGMAPPTTPCSTDVCDSDY
SASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCT
DSS
NT seq 6852 nt   +upstreamnt  +downstreamnt
atggccgcgccgccggcctgcgagtcccactggggctgcagcgagaaagttctgcgaccg
gcgcgggaagtcctggcctgttgcgctgccccctttgacgttgctgtgtttccaagcggg
ctgccacctgccaggtgtccgtccggccggccggtgggccccaaacggtggcgcccggcc
cagctgaccgatgtcccccccccgggggctggcggcgtgggcccgccgagccgggtgtcg
ggtcggtcccatcagaggaacgtgcgtgtttctcggtgtgcacacctttggcgggatcga
gagttggggaactttctccccgactttcagtgccgcctgtaccagctgaggcggggcgag
ggagccacccaggcagaggcggcccccctggtgcagccccagggccaccgccgggtcctc
tgggggaagccagttccccagcctggtggcgggaaccccgacagttctctggatggggat
aatgacgagtgtgtgcggctgagagcttgtgggaccggacgggtcgtgtgcgggtgtggc
ctgcaaagagctctcagcctcgtgacacccaacattccttactactccctggacctgcct
tgggcctcaccgctcctgctgtttgccaaccgccgggacgtgcggctggtggatgctggt
ggcgtcaagctggagtccaccatcgtggtcagcgggctggaggatgcagccgctgtggac
ttccagttctccaaaggagccgtgtactggacggatgtgagcgaggaagccatcaagcag
acgttcctgaaccagacaggcgctgccgtgcagaatgtcatcatctcgggcctggtctcc
cctgacgggctggcctgcgactgggtcggcaagaagctgtactggacggactcggagacc
aaccgcatcgaggtggccaacctcaacgggacatcccgaaaggtgctcttctggcaggac
ctggaccagcctcgggccatcgccctggaccctgcccacgggtacatgtactggacggac
tggggtgagacgccccgcatcgagcgggcgggcatggacggcagcacccggaaaattatt
gtggactcggacatttactggcccaacgggctgaccatcgatctggaagagcagaagctg
tactgggccgacgccaagctcagcttcatccaccgtgccaacctggacggctcgttccgg
cagaaggtggtggagggcagcctgacgcacccctttgccctgacgctgtctggggagacg
ctgtactggacggactggcagacccgctccatccacgcctgcaacaagaggacgggggga
gaagaggaagagatcttgagcgccctctactcgcccatggacattcatgacggcttcaac
atgatggtcctggtgccaggtgtacttgggcaccagccagcacgggctgggttcctgcat
acgtcaggcctctgctgcctggtagtgaatgacctcagggtggaactgtccccacagaca
cctgtgggctctaaccggaggattagcagccagccctgcccttccggcaggaagcgttcc
caggccagggctggcagccaggaggtgctgacggtgcagtccctggcctctcattttgga
cagatgaaagccagctcagtggagggattggatcccccccgggaagggggtggtgtggtg
atgatgctggagtccagtgaacgggaagtacccagggggggcccttcctgggtcggctgc
gaccacacgcgccccccgctgcccagccagggcctcccaggcctcggtgtgaacagacgg
tggcctagcggcctcctgccgcctccacccctccgcgcagcctcgcacccggcggcgcac
agctggctttgggtgtggagcccccggccgcccaaccacgagccctgcagagggagcctc
gcaaaccgactccaggctccagcctgcctggctcgtgttgcccccgtgcctctgatcctt
gctggatttggtgatggctcaggctccctggcccccctgagcaagcccttgtgtggggct
gacgcctcggccggctgcagttgcttccaaaaagctgcagttcccgcgcacactggggcg
tggggggcgggagccaggggacagctgctggggcctcagcttgtgaacggagccagcccc
agatttggccccttcctgtgtgcctgtgaccttgtggtcatttggcgtggcttcctagac
cggcgtgatgggctgtggcctcagggtttgtccaatggcttaccccaggggacggtggag
aaacttaatcgatggctaaaaaacgaatgtaggccggcctcctgccggccacggagccac
ctagtcaggctgttcatgcccttgaatgctcagagcactgatggcctgcactgggatggt
ccaggccgggaggggccccagtgcctcagtgggcgcagcgcaggggcgcctggggctgga
ggggactccagagctggggaccgagctcgggggcccctccgcgtgggctttgtcctgggc
ccccatgtgtcagccagagcgttcctggggctggagagtggcagacggtgtgaggctgtg
aggagcactcagcccatccacagcagtaagggaggccgggaggacatcctggaggaggag
ctgggaagtgggcacccggtgcaggaggccatctgttgtccgagggctcagttcagccgg
gcacagcagagccgaggcctggaggcctggccaggcatgtggtccagagcgctggaagtg
gcctgtggccctgacctcctcagttctggggtcctcgagaccagaaagggcctgaagaaa
ggagcagatgatgagacagctctgcagaggagttatcacccatccccagccagggagtcc
ctcatcttgtgctccatgagcgtccgggcagtggatgaagagtggctgtgtagagggagc
ttggtgaacgttgctgagcagtgtcttttgtcaccctccctgccgtgcctgtccgggcct
ctgaccactgcgcctgtctccccaggggccgaggaggtgttgctactggcccggcggaca
gacctacggaggatctcgctggacacgccggacttcacggacatcgtgctgcaggtggac
gacatccggcacgccatcgctatcgactatgacccgctggaaggctacgtctactggacg
gacgacgaggtgcgggccatccgcagggcctacctggacggctcgggcgcacagacgctg
gtcagcaccgagatcaatgaccccgacggcattgcggtcgactgggtggcccgcaacctc
tactggactgacacgggcaccgaccgcatcgaggtaacacgtctcaacggcacctcccgc
aagatcctggtgtccgaggacctggaggagccacgtgccattgtgctacaccccatgatg
ggcctcatgtactggacagactggggtgaaaatcccaaaatcgaatgcgcccaccttgat
ggacaggagcggcatgtcctagtgaacacctccctcgggtggcccaacggcctggcccta
gacctgcaggagggaaagctgtattggggggacgcgaagacagacaagattgaggtgatc
agcgtggatgggaccaagaggcggacgctgttggaggacaagctcccacacatcttcggg
ttcacactgctgggagacttcatctactggactgactggcagaggcggagcatcgagcgg
gcgcacaaggtcaaggcgaaccgtgacgtcatcatcgaccagctgcccgacctgatgggg
ctcaaagccgtgaacgtggccaaggtcatcggaaccaacccgtgtgcggacaggaacggg
ggctgcagccacctgtgctttttcacaccccacgccaccaagtgcggctgccccatcggc
ctggagctgctgagcgacctaaagacatgcattgtccccgaggccttcctcgtgtttacc
agccgagccgccatccacaggatctcgctcgagaccaccaacaacgacgtggctatcccc
ctcacgggcgtcaaggaggcctccgcgctggactttgacatgtccagcaatcacatctac
tggacggatgtcagcctgaagaccatcagccgagccttcatgaacgggagctcagtggag
cacgtgattgagtttggtcttgactacccagaaggcatggctgttgactggatgggcaag
aacctctactgggctgacaccgggaccaacaggatcgaagtggcccggctggacgggcag
tttcgacaggtccttgtctggagggacttggacaacccgaggtcactggccctggatccc
accaaaggctacatctactggaccgagtggggcggcaagccgaggattgtgcgggccttc
atggatgggaccagctgcatgacgctggtggacaaggtcggccgggccaatgacctgacc
attgactatgctgaccagcgcctctactggaccgacctggacacgaacatgattgagtcg
tccaacatgctgggccaggagcgcatcgtgattgccgatgacctcccgcaccccttcggc
ctgacgcagtacagcgactacatctactggaccgactggaacctgcatagcattgagcgg
gccgacaagaccaacggacggaaccgcaccctcatccagggccacctggacttcgtgatg
gacatcctggtgttccactcctcccgacaggacggcctcaatgactgcgtgcagaacaac
gggcagtgtgggcagctgtgcctcgccgtccccggcggccaccgctgcagctgcgcttca
cactacaccctggaccccagcagccgcaactgcagcccacccacagccttcttgctgttc
agccagaaatgctccatcagtcgggtgatccccgatgacccccacagcccggacctcatc
ctgccgctgcacgggctgaggaacgtcaaggccgtcgactacgacccactggacaagctc
atgtactgggtggatgggcgccagaacatcaagagagccaaggacgacgggactcagccc
tacgtcttgacttcgcctggccagagctcagaccggcagccccatgaccttagcattgac
gtctacagccggacgctgttctggacgtgcgaggccaccaacaccatcaacgtccaccgg
ctgagcggggaggccatgggcgtggttctccgtggggaccgagacaagcccagggccatc
accgtcaacgcggagcgagggtacctgtacttcaccaacatgcaggaccgcacggccaag
attgagcgtgctgctctggatggcacggagcgcgaagtcctcttcaccactggcctcatc
cgccccgtggccctcgtggtggacaacaggctgggcaagctcttttgggtggatgcagac
ctgaagcgcattgagagctgcgacctgtcaggggccaaccgcctgaccctggaggacgcc
aacattgtgcagcccgtgggcctggccgtgcttggcagccatctctactgggctgaccgc
cagcagcaaatgatcgagcgcgtggagaagatcaccgggtaccagcggacacgcgtacag
ggccggattgcccacctcaccggcatccatgccgtggaggaagtcagcacggaggagttc
ttggcccacccgtgtgcccgggacaatggcggctgctctcacatctgcattgccaagggc
gacggcacaccgcgttgctcgtgccctgtccacctggtgctcctgcagaacctccttacc
tgtggtgagccccccacgtgctcccctgaccagtttgcatgcgccacgggtgagatcgac
tgcatccctgcggcctggcgctgtgacggcttccctgagtgcgacgaccagagcgacgag
gacggctgccccgtgtgctcagccgcccagttcccgtgcgagcgtggccagtgtgtggac
ctgcgcctgcgctgcgatggcgaggccgactgccaggaccgctcggatgaagctgactgt
gatgccatctgcctgcccagccagttccggtgcgccagcggccagtgcgtgctcatcaag
caacagtgcgactccttccccgactgcatggacggctcagacgagctcatgtgtgaaatc
accaagccacctgcggatgacaccctgacccacagcagtgccatcggaccagtcattggt
atcattctctcgctcttcgtcatgggtggcgtctatttcgtatgccagcgtgtggtgtgc
cagcgctatgcgggggccaacgggcccttcccacacgaatatgtcagcgggaccccccac
gtgcccctcaacttcatagccccaggcggtgctcagcacggtcccttcacaggcatctca
tgcagcaagtccatgatgaactcggtgagcctgatggggggccggggcggggtgcccctc
tacgaccggaaccatgtcaccggggcctcgtccagcagctcgtccagcaccaaggccacg
ctctacccaccgatcctgaacccaccaccgtcccctgccacagacccctccttgtacaac
atggacacgttctactcttcaaacattcctgcctccacaagaccatacaggccttatatc
atccgcggcatggcgccccctacgacaccctgcagcaccgacgtgtgtgacagcgactac
agcgccagccgctggaaggccagcaagtactacctggacctgaactcggactcagacccc
tacccgcccccgcccacgccccacagccagtacctgtcggcggaagacagctgcccacca
tcgcccgccacagagaggagctactttcacctcttcccacccccgccgtccccctgcacg
gactcgtcctga

DBGET integrated database retrieval system