KEGG   Loxodonta africana (African savanna elephant): 100658790
Entry
100658790         CDS       T04351                                 

Gene name
SLC8A1
Definition
(RefSeq) sodium/calcium exchanger 1 isoform X2
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav04740  Olfactory transduction
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04974  Protein digestion and absorption
lav04978  Mineral absorption
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100658790 (SLC8A1)
   04020 Calcium signaling pathway
    100658790 (SLC8A1)
   04022 cGMP-PKG signaling pathway
    100658790 (SLC8A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100658790 (SLC8A1)
   04261 Adrenergic signaling in cardiomyocytes
    100658790 (SLC8A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    100658790 (SLC8A1)
   04978 Mineral absorption
    100658790 (SLC8A1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100658790 (SLC8A1)
  09157 Sensory system
   04740 Olfactory transduction
    100658790 (SLC8A1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100658790 (SLC8A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100658790 (SLC8A1)
   05414 Dilated cardiomyopathy
    100658790 (SLC8A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100658790 (SLC8A1)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100658790 (SLC8A1)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   100658790 (SLC8A1)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Others
   100658790 (SLC8A1)
SSDB
Motif
Pfam: Na_Ca_ex Calx-beta Na_Ca_ex_C DnaG_DnaB_bind
Other DBs
NCBI-GeneID: 100658790
NCBI-ProteinID: XP_010594196
LinkDB
Position
Unknown
AA seq 934 aa
MLQLNLSPTFSMGFHLLAIVALLFSHVDHTSAESEMEGEGNDTGECTGSYYCKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPPSKTEIEMDGKVVNSHVDNF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVAENDPVSKIFFEQGTYQCLENCG
TVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEVRVGIIDDD
IFEEDENFLVHLSNVKVSSEASEDGILEANHVSALACLGSPSTATVTIFDDDHAGIFTFE
EPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIV
KIITIRIYDREEYEKECSFSLVLEEPKWIRRGMKGAFTITEECDDKQPLTSKEEEERRIA
EMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGED
DDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIG
DLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVF
LGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGG
PRTAKLLTSCLFVLLWLLYIFFSSLEAYCHIKGF
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgttgcaattaaatctctcacccaccttttctatgggatttcatctgttagccattgtg
gctctcttattttcccacgtggaccatacaagtgctgagagcgaaatggaaggagaagga
aatgacactggtgaatgtaccggctcatattactgtaagaaaggggtgattttacccatt
tgggagccccaagacccttcctttggggacaaaattgctagagctactgtgtattttgtg
gccatggtctacatgtttcttggagtatctatcattgctgaccggttcatgtcctctata
gaagtcattacatctcaagaaaaagaaataaccataaagaaacccaatggagagaccacc
aagacgaccgtaaggatctggaatgagacagtttctaatctaaccttgatggccctggga
tcttctgctcctgagattctcctttcagtcattgaagtgtgtggccataatttcactgca
ggggacctgggtcctagcaccatcgtaggaagtgctgcattcaatatgttcatcattatc
gccctctgcgtttatgtggtccctgatggagagacgaggaagattaagcatttgcgtgtg
ttctttgtgacagcagcctggagcatctttgcctatacctggctttacattattttgtct
gtcatctctcctggagttgtggaagtctgggaaggcttgcttactttcttctttttcccc
atttgtgtggtatttgcttgggtggcagataggaggcttctgttttacaagtatgtctac
aagaggtatcgggctggcaagcagagggggatgattattgaacatgaaggagacaggcca
ccttccaagaccgaaattgaaatggatgggaaagtggtcaattctcatgttgacaatttc
ttggatggcgctctggtgctggaggttgatgagagggaccaagatgatgaagaggctagg
cgagaaatggctaggatcctgaaggaactcaagcagaagcatccggacaaagaaatagag
caattaatagaattagctaactaccaagtcctaagtcagcaacaaaagagtcgagcattt
taccgcattcaggctactcgcttgatgacgggagctggcaacattttaaagaggcatgca
gctgaccaagcaaggaaggctgtcagcatgcacgaggtcaacactgaggttgcagaaaat
gatccagttagtaagatcttctttgagcaagggacatatcagtgtctagagaactgtggg
accgtggccctgaccataatccgccgaggtggcgatttgaccaacactgtgtttgttgac
ttcagaacagaggatggcacagccaatgctgggtctgattatgaatttactgaaggaact
gtagtctttaagcccggtgagacccagaaggaggtcagagttggcatcatcgatgatgat
atctttgaggaggacgaaaatttccttgtgcatctcagcaatgtcaaagtgtcttctgaa
gcttcggaagatggcatactggaagccaatcatgtctccgcacttgcttgcctcggatct
ccctctactgccaccgtgacgatttttgatgatgaccacgcaggcatctttacttttgag
gaacctgtgactcatgtgagcgagagtattggcatcatggaggtgaaagtattgagaaca
tccggagcacgaggaaatgtcatcgttccctataaaaccattgaagggactgccagaggt
ggaggagaagactttgaggacacttgtggagagctcgaattccagaatgatgaaattgtg
aagatcattaccattagaatatatgaccgtgaggaatatgagaaagagtgcagtttctcc
cttgtgcttgaggaaccaaaatggataagaagaggaatgaaaggtgccttcacaataaca
gaggaatgtgatgacaagcagccgttgaccagcaaagaggaagaagagaggcgtattgcg
gaaatggggcgccccatcctgggagagcacaccaagctggaagtgatcattgaggaatcc
tatgagttcaagagtactgtggacaaactcattaagaagacaaacctagccctcgtggtt
gggaccaacagctggagagagcagttcattgaagcgatcactgtcagcgctggggaagat
gatgacgacgatgaatgcggggaggagaagctgccctcctgtttcgattatgtgatgcac
tttctgactgtgttctggaaggtcctctttgccttcgtccccccgacagaatactggaat
ggctgggcatgtttcattgtatccatcctcatgattggcctactgacagctttcatcgga
gacctggcttcccacttcggctgcaccattggcctgaaagattccgtgactgcggtggtg
tttgttgcacttggaacttcagtgccagacacgttcgcaagcaaagtggcagccacccag
gaccagtatgcagatgcgtccataggtaacgtcactggcagcaacgcggtgaatgtcttc
ctgggaatcggcgtggcctggtccatcgctgccatctaccacgcagccaatggggaacag
ttcaaagtgtcccctggcacgctagctttctctgtcactctcttcaccatttttgctttc
atcaatgtgggggtgctgctgtatcggcggaggccagaaatcggaggtgagctgggtggg
ccccggactgccaagctcctcacatcctgcctctttgtgctcctgtggctcttgtacatt
ttcttctcctccctggaggcctactgccacataaaaggcttctga

KEGG   Loxodonta africana (African savanna elephant): 100661888
Entry
100661888         CDS       T04351                                 

Gene name
SLC8A2
Definition
(RefSeq) sodium/calcium exchanger 2
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav04740  Olfactory transduction
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04974  Protein digestion and absorption
lav04978  Mineral absorption
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100661888 (SLC8A2)
   04020 Calcium signaling pathway
    100661888 (SLC8A2)
   04022 cGMP-PKG signaling pathway
    100661888 (SLC8A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100661888 (SLC8A2)
   04261 Adrenergic signaling in cardiomyocytes
    100661888 (SLC8A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    100661888 (SLC8A2)
   04978 Mineral absorption
    100661888 (SLC8A2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100661888 (SLC8A2)
  09157 Sensory system
   04740 Olfactory transduction
    100661888 (SLC8A2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100661888 (SLC8A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100661888 (SLC8A2)
   05414 Dilated cardiomyopathy
    100661888 (SLC8A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100661888 (SLC8A2)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100661888 (SLC8A2)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   100661888 (SLC8A2)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Others
   100661888 (SLC8A2)
SSDB
Motif
Pfam: Na_Ca_ex Na_Ca_ex_C Calx-beta
Other DBs
NCBI-GeneID: 100661888
NCBI-ProteinID: XP_023399817
LinkDB
Position
Unknown
AA seq 870 aa
MGRDLLNSPRTPLPLHRTPPPPMAPLALVGVALLLGVPPGLGAATPTPSPPPPLANDSDA
SMGSCQGSNRCQPGVLLPVWEPDDPSLGDKVARAVVYFVAMVYMFLGVSIIADRFMASIE
VITSKEKEITITKANGETSVGTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAG
ELGPGTIVGSAAFNMFVVIAVCIYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAV
FSPGVVQVWEALLTLVFFPVCVVFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPK
SIELDGTFVGAAEGPGAELGGLGLGPGPGPAEARELDASRREVIQILKDLKQKHPEKDLE
QLVGIANYYALLHQQKSRAFYRIQATRLMTGAGNVLRRHAADASRRAIPAEGPGEDEDDG
ASRIFFEPSLYHCLENCGSVLLSVTCQGGEGNSTFYVDYRTEDGSAKAGSDYEYRHQPPP
YPDVRSLTSPACPTAQNADGARPMPAPSASAVSNRRVNLASRGGGLILGILPSPHPRKTL
QVKIVDDEEYEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEARRIAEMGKP
VLGENCRLEVIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAITVSAGDEEEEED
GSREERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVCILVIGLLTALIGDLAS
HFGCTVGLKDSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLG
VAWSVAAVYWAAQGRSFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGP
KLATTALFLGLWLLYILFASLEAYCHIRGF
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggggagggatttgctcaactcacccagaaccccccttcccctccacaggaccccgcca
ccccccatggctcccctggccttggtgggggtcgcactcctcctgggggtgccccctggc
ttgggggcggccaccccgaccccctccccaccgcctcccctggccaatgacagtgatgct
agcatggggagctgccagggctccaaccgctgtcagccgggggtcctgctgcctgtgtgg
gagcccgacgacccatctctgggtgacaaggtggcgcgggctgtggtctactttgtggcc
atggtctacatgttcctgggcgtgtccatcatcgctgaccgcttcatggcctccatcgag
gtcatcacgtccaaggagaaggagatcactatcaccaaggccaatggtgagacaagtgtg
ggcaccgtccgcatctggaacgagactgtgtccaacctcacgctcatggctctgggttcc
tcggcccccgagatcttgctgtctgtcatcgaggtctgcggtcacaacttccaggcgggc
gaactgggcccaggcaccatcgtgggcagtgctgccttcaacatgtttgtagtcattgcc
gtgtgtatctatgttatcccggctggggagagccgcaagatcaagcacctgagagtcttc
ttcgtcactgcctcctggagcatcttcgcctatgtctggctttatctcatccttgctgtc
ttttccccaggcgtggtgcaggtgtgggaggcgctgctgaccctggtcttcttcccggtg
tgcgtggtgttcgcctggatggctgacaagcggctgctcttctacaagtacgtgtacaag
cgctaccgcaccgacccgcgcagtggcatcattattggcgccgagggagaccccccgaag
agcatcgagctggatggcacgttcgtgggcgcagccgaggggccgggggccgagctgggt
ggcctgggcctgggcccgggcccgggcccggctgaggcgcgcgagctggacgccagccgc
cgcgaggtcatccagatccttaaggacctcaagcagaagcacccggagaaggacctggag
cagctggtgggcatcgccaactactacgcgctgttgcaccagcagaagagccgcgccttc
taccgcatccaggccacccggctgatgaccggcgcaggcaacgtactgcgcagacatgcg
gcggatgcgtcgcgcagggccatcccggccgagggccctggagaggacgaggacgacggt
gccagccgcatcttcttcgagcccagcctctaccactgcctggagaactgcggctcggtg
ctgctctccgtcacctgccagggcggtgaaggcaacagcaccttctacgtggactaccgt
accgaggatggctcggccaaggccggctccgactatgagtacagacatcagccaccccct
tacccagatgtccgcagcctcacctcccccgcctgcccgactgcccagaatgcagacggc
gcccgccccatgcctgctccatccgcctccgcagtgtctaataggagagttaatctggca
agtcggggagggggccttatcctgggtattctcccctcgcctcatcccaggaaaactctt
caggtgaagatagtggatgacgaggaatatgagaaaaaggataatttcttcattgagctg
ggccagccccagtggctaaagcgaggcatttcagctctgctactcaatcaaggggatgga
gacaggaagctgacggctgaggaggaggaggcgcggaggatagcagagatgggcaagccg
gttcttggggaaaattgtcggctagaggtcataatcgaggagtcgtatgattttaagaac
acggtggataaactcatcaagaagacgaacttggctttggtgattggaactcactcgtgg
agggagcagtttttagaggcaattacggtgagcgcaggggacgaggaggaggaggaagac
gggtcccgagaggagcggctgccgtcctgctttgactacgtgatgcacttcctgacggtg
ttctggaaggtgctgtttgcctgcgtgcctccgaccgagtactgccatggctgggcctgc
tttggtgtctgcatcctggtcattggcctgctcactgccctcattggggacctcgcctcc
cactttggctgcactgttggcctcaaggactctgtcaacgctgttgtcttcgtggccctg
ggcacctccattcctgacacattcgccagcaaggtggcggcgctgcaggaccagtgcgcg
gacgcgtcaatcggcaatgtgaccggctccaacgcggtgaacgtgttcctgggcctgggc
gtggcctggtcggtggccgccgtgtactgggcggcgcagggccgctccttcgaggtgcgc
acgggcacgctggccttctccgtcactcttttcacagtcttcgccttcgtgggcatcgcc
gtactgctgtaccgccgccggccgcacatcggcggcgagctgggtggcccccgcggcccc
aagctcgccaccaccgcgctcttcctaggcctctggttgctctatatcctcttcgctagc
ctcgaggcctactgccacatcaggggcttctag

KEGG   Loxodonta africana (African savanna elephant): 100666349
Entry
100666349         CDS       T04351                                 

Gene name
SLC8A3
Definition
(RefSeq) sodium/calcium exchanger 3
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav04740  Olfactory transduction
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04974  Protein digestion and absorption
lav04978  Mineral absorption
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100666349 (SLC8A3)
   04020 Calcium signaling pathway
    100666349 (SLC8A3)
   04022 cGMP-PKG signaling pathway
    100666349 (SLC8A3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100666349 (SLC8A3)
   04261 Adrenergic signaling in cardiomyocytes
    100666349 (SLC8A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    100666349 (SLC8A3)
   04978 Mineral absorption
    100666349 (SLC8A3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100666349 (SLC8A3)
  09157 Sensory system
   04740 Olfactory transduction
    100666349 (SLC8A3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100666349 (SLC8A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100666349 (SLC8A3)
   05414 Dilated cardiomyopathy
    100666349 (SLC8A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100666349 (SLC8A3)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100666349 (SLC8A3)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   100666349 (SLC8A3)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Others
   100666349 (SLC8A3)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 100666349
NCBI-ProteinID: XP_010587207
LinkDB
Position
Unknown
AA seq 931 aa
MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEASGSGDVPSTGQNNESCSGSSECKQGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADRRMLFYKYMHKKYRTDKHRGIIIETEGEHPKGIEMDGKMMNSHFLDGN
LVALEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKTSSMSEVHTDEPEDFVSKVFFDPCSYQCLENCGAVLLTVVR
KGGDTSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRMEEDQQEEGMPPAIFNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIHI
KVIDDEAYEKNKNYFIEMMGPRMVDMSFQKALLLSPDRKLTVDEEEAKRIAEMGKPILGE
HPKLEVIIEESYEFKCTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDESGEE
RLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFGCT
IGLKDSVTAVVFVAFGTSVPDTFASKAAAIQDVYADASIGNVTGSNAVNVFLGIGLAWSA
AAIYWALQGQEFHVSAGTLTFSVTLFTIFAFVCISVLPGGLESRNAQGVGVLVPVLATLR
IWNAFPSGGKSYFSPGQPPLEKAKYHVTCQL
NT seq 2796 nt   +upstreamnt  +downstreamnt
atggcgtggttacggttgcagcctctcacctctgccttcctccattttgggctggttact
tttgtgctcttcctgaatggtctccgtgcagaggctagtggctcaggggatgtgcccagc
acagggcagaacaatgagtcctgttcagggtcatcggagtgcaagcagggtgtcatctta
ccaatctggtacccggagaacccttcccttggggacaagatcgccagggtcattgtctat
tttgtggccctgatatacatgttccttggagtgtccatcattgctgatcgcttcatggca
tctattgaagtcattacctctcaagaaagggaggtgactatcaaaaagcccaatggagag
accagcacaaccacgattcgggtctggaatgaaactgtctctaacctgacccttatggca
ttgggctcctctgctcctgagatcctcctctctttaattgaggtatgtggtcatgggttc
attgctggtgatctgggaccttcaaccatcgtaggcagtgcagccttcaacatgttcatc
atcattggcatctgtgtctatgtgatccctgatggagagactcgaaagatcaagcaccta
cgagtcttctttgttactgccgcttggagcatctttgcctacatctggctctatatgatc
ctggcagtcttttctcctggtgtggtccaggtttgggaaggcctcctcactctctttttc
tttccagtgtgtgtccttctagcctgggtggcagataggcgaatgctcttctacaaatac
atgcataaaaagtaccgtacagataaacaccgaggaataatcatagagacagaaggtgaa
caccccaagggaattgagatggatggcaaaatgatgaattcccactttctagatggaaac
ctggtggccctggaagggaaggaagttgatgagtcccgtagggagatgatccggattctc
aaggatctgaagcaaaaacacccagagaaggacttagatcagctggtggagatggccaat
tactatgccctttcccaccaacagaagagccgcgccttctaccggatccaagccactcgt
atgatgactggtgcaggtaatatcctaaagaaacatgcagcagaacaagccaagaagacc
tccagcatgagtgaggtgcataccgatgagcctgaggactttgtctccaaggtcttcttt
gatccatgttcctaccagtgcctggagaactgtggggctgtactcctgacagtggtaagg
aaaggcggggacacgtccaagaccatgtatgtggactacaaaacagaagatggttctgct
aacgcaggggctgactatgagttcacagagggcactgtcgttctgaagccaggagagacc
cagaaggagttctctgttggtatcatagatgatgacatctttgaggaggatgaacacttc
tttgtgaggctgagcaatgtacgcatggaggaagatcagcaggaggagggcatgcctcca
gcaatattcaacagtcttcccttgcctcgggctgtcctagcatccccttgtgtggccaca
gtcaccatcttggatgatgaccatgcaggcatcttcacttttgaatgtgatactattcat
gtcagtgagagtattggtgtcatggaggtcaaggttctgcggacatcaggtgcccggggc
acagtcatcgtcccctttaggacagtagaagggacagccaagggtggtggtgaggacttc
gaagacacatatggggagttggaattcaagaatgatgaaactgtcaaaacaattcacatc
aaggtaattgatgatgaggcgtatgagaaaaacaagaattacttcattgagatgatgggc
ccccgcatggtggatatgagttttcagaaagcgctcctgttgtctccagacaggaagctg
actgtggatgaagaggaggccaagagaatagcagagatgggaaagccaatattgggtgaa
caccccaaactagaggtcatcattgaagagtcttatgagttcaagtgtacggtggacaaa
ctgattaagaagacaaatctagctttggttgtgggaacccattcctggagggaccagttc
atggaagccatcactgtcagtgcagcaggggacgaagatgaggatgagtcaggcgaagag
agactgccgtcctgctttgactatgtcatgcacttcttgacggtcttctggaaggtgctg
tttgcctgtgtgcctcccacagagtactgccacggctgggcctgctttgttgtctccatc
ctcatcatcggcatgctcaccgccataatcggggacctggcctctcactttggctgcacc
attggcctcaaggattccgtcacggctgttgtttttgtggcatttggcacctctgtgcca
gatacatttgctagcaaagcagccgccatccaggacgtgtatgcagatgcctccattggc
aacgtcacaggcagcaacgcagtcaacgtcttcctgggcattggcctggcctggtctgcg
gctgccatctactgggccctgcagggacaggagttccacgtgtcagcaggcacactgacc
ttctctgttaccctcttcaccatctttgcgtttgtctgcatcagcgtgctacctgggggt
ctggaaagcaggaatgcacagggtgtgggagtactcgtacccgtgctagctactcttagg
atctggaatgccttcccttctggcggcaagtcctacttctccccaggccagcctcccttg
gagaaggccaaataccacgtgacctgccagctttga

DBGET integrated database retrieval system