KEGG   Loxodonta africana (African savanna elephant): 100658957
Entry
100658957         CDS       T04351                                 

Definition
(RefSeq) uroplakin-3a-like
  KO
K19520  uroplakin-3a
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    100658957
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100658957
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100658957
SSDB
Other DBs
NCBI-GeneID: 100658957
NCBI-ProteinID: XP_010588743
LinkDB
Position
Unknown
AA seq 143 aa
MLASVTFTTNNLTLTTVALEKPLCMFESNAALVGTYEVYLYIFPDRLTPCSVIDKWPGRR
RGGMVFITAILGSQPFFRLLGFTGAIVLSSVDMGSPDGETAHDFQIMQEAVPKSLGTSKP
SYTSVNRGPPLDRAEVYSSKVQD
NT seq 432 nt   +upstreamnt  +downstreamnt
atgctggccagtgtgaccttcaccactaacaacctcacactcaccactgtggcattggag
aagccgctctgcatgtttgaaagcaacgctgcccttgttggcacctacgaggtctacctc
tacatcttccctgaccggctcaccccgtgctcagtgattgacaagtggcctgggaggcgg
aggggaggcatggtcttcatcacggccatcctgggctcccagcccttcttccggctcctg
gggttcacgggtgccatcgtcctcagctctgtggacatggggagtccagatggggaaacg
gcacatgacttccagatcatgcaggaggccgtccccaagtctctggggacctcaaaacct
tcgtacacatctgtgaaccgggggcctcccctggacagggccgaggtatattccagcaag
gtccaggactga

KEGG   Loxodonta africana (African savanna elephant): 100659478
Entry
100659478         CDS       T04351                                 

Gene name
UPK3A
Definition
(RefSeq) uroplakin-3a
  KO
K19520  uroplakin-3a
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    100659478 (UPK3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100659478 (UPK3A)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100659478 (UPK3A)
SSDB
Motif
Pfam: PTP_tm
Other DBs
NCBI-GeneID: 100659478
NCBI-ProteinID: XP_023395779
LinkDB
Position
Unknown
AA seq 347 aa
MAEQRRAWAQLTELPRLRETQGHFRLRDQHGQSGGWRQHGQSWELQVVDTLVCPWAEVPI
GVDNSARAERPSPLSPPAVNLQPQLASVTFTTNNPTLTTVALEKPLCMFESNTALVGTYE
VYLYVLAESASLRNASIQDHTSAPLSSTFQQTEGGRTGPYKAAAFDLQPCSDLPSLDAVE
DVSRASEILSTYLVRVGANGTCLSDPNFQGLCNPPLSVATEYRFKYVLVNMSTGLVQDQT
LWSDPIRTNRLTPYSAIDTWPGRRSGGMIVITAILGSLPFFLLLGFAGAVLLSFVDVGSP
DGETTHDSQITQEAVPKSLATSEPSYASVNRGPPLDRAEVYSSKLQD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcagagcagagaagggcctgggcccagctcacggagctgcctagactgcgggagacc
cagggacatttcaggctgagggaccagcatgggcagtcagggggctggaggcagcatggc
cagtcgtgggagctgcaagtcgtcgacacactggtgtgtccatgggcagaggtgcccata
ggtgtggacaattctgccagggctgaacgcccatccccattgtcccctccagctgtgaac
cttcagccccagctggccagcgtgaccttcaccaccaacaaccccacgctcaccactgtg
gcattggagaagccgctctgcatgtttgaaagcaacactgcccttgttggcacctacgag
gtctacctctacgtcctcgctgagtcggccagcctcaggaacgcctccatacaggaccac
accagtgccccgctgagctcgacattccagcaaacagagggcgggcggacaggcccctac
aaggccgcggcctttgatctgcagccctgcagcgacctgcccagcctggatgccgtggag
gatgtgtcccgggcctcagagatcctcagcacatacctggtcagggtaggcgccaatggg
acctgcctgtccgaccccaacttccagggcctctgcaacccacccctgtcggtggccacg
gaatacaggttcaagtacgtccttgtcaatatgtccacgggcttggtacaggaccagacc
ctctggtcggaccccattcgcaccaaccggctcaccccttactcagcgattgacacgtgg
cctgggcggcggagcggaggcatgattgtcatcacagccatcctgggctccctgcccttc
ttcctgctcctgggattcgcgggtgccgtcctcctcagctttgtggacgtggggagtcca
gatggggaaacgacacatgactcccagatcacgcaggaggccgttcccaagtctctagcg
acctcagagccttcgtacgcatctgtgaaccgggggcctcccctggacagggctgaggtg
tattccagcaagctccaggactga

DBGET integrated database retrieval system