KEGG   Loxodonta africana (African savanna elephant): 100659413
Entry
100659413         CDS       T04351                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04710  Circadian rhythm
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav05410  Hypertrophic cardiomyopathy
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100659413 (PRKAA1)
   04068 FoxO signaling pathway
    100659413 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    100659413 (PRKAA1)
   04152 AMPK signaling pathway
    100659413 (PRKAA1)
   04150 mTOR signaling pathway
    100659413 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100659413 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100659413 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100659413 (PRKAA1)
   04922 Glucagon signaling pathway
    100659413 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100659413 (PRKAA1)
   04921 Oxytocin signaling pathway
    100659413 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    100659413 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    100659413 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100659413 (PRKAA1)
   04714 Thermogenesis
    100659413 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100659413 (PRKAA1)
   05410 Hypertrophic cardiomyopathy
    100659413 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100659413 (PRKAA1)
   04931 Insulin resistance
    100659413 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100659413 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100659413 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100659413 (PRKAA1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100659413 (PRKAA1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100659413 (PRKAA1)
Membrane trafficking [BR:lav04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100659413 (PRKAA1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100659413 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100659413 (PRKAA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 100659413
NCBI-ProteinID: XP_003408055
UniProt: G3TJJ9
LinkDB
Position
Unknown
AA seq 559 aa
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEDEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHFTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRNDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacatcctgggggatacgctgggggtcggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagttgctgtgaagatactaaatcga
cagaagattcgaagccttgacgtggtaggaaaaatccgcagagaaattcagaacctcaaa
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggctggatgaaaaagaaagtcgacgtctgttccaacaaatcctttctggtgtggattat
tgtcacaggcatatggtggtccaccgagatttgaaacctgaaaatgtcctgcttgatgca
cacatgaatgcaaagatagctgattttggtctttccaacatgatgtcagatggtgaattt
ttaagaacaagttgtggctcacccaactatgccgcgccagaagtaatttcaggaagactg
tatgcaggtccagaggtagatatatggagcagtggggttattctctatgctttattatgt
ggaaccctgccatttgatgatgatcatgtgccaactctctttaagaagatatgtgatggg
atcttttatacccctcagtatttaaatccttctgtgattagccttttgaaacatatgctg
caggtggatccgatgaagagggccacaatcaaagatatcagggaacatgaatggtttaaa
caggaccttccaaaatatctctttcctgaagatccatcatatagttcaaccatgattgat
gacgaagccttaaaagaagtgtgtgaaaaatttgaatgctcagaagatgaagttctcagc
tgcctttatagcagaaatcaccaggaccctttggcagttgcttatcacctcataatagat
aacaggagaataatgaatgaagccaaagatttttacttggcaacaagcccacctgattct
tttctggatgatcaccattttactaggcctcaccctgaaagggtaccatttttggttgct
gaaacaccaagggctcgtcataccctcgatgaattaaatccacagaaatccaaacaccaa
ggtgtaaggaaagcaaaatggcatttgggaattagaagtcaaagtcgaccaaatgatatc
atggcagaagtttgtagagcaattaaacaattggattatgaatggaaggttgtaaatcca
tattatttgcgtgtccgaaggaagaatccggtgacaagtacatactctaaaatgagtcta
cagttatatcaagtggatagtagaacttacttactggatttccgtagtattgatgatgaa
attactgaagccaaatcagggactgccacgccacagagatcgggatcagtgagcaactat
cgatcttgccaaaggaacgattcagatgctgaggctcagggaaaatcctccgaagtttct
cttacctcatctgtaacctcacttgactcttctcctgttgacttaactccaagacctgga
agtcacacaatagaattttttgagatgtgtgcaaatctaattaaaattcttgcacagtaa

KEGG   Loxodonta africana (African savanna elephant): 100665273
Entry
100665273         CDS       T04351                                 

Gene name
PRKAB2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2 isoform X1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04710  Circadian rhythm
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100665273 (PRKAB2)
   04068 FoxO signaling pathway
    100665273 (PRKAB2)
   04152 AMPK signaling pathway
    100665273 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100665273 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100665273 (PRKAB2)
   04922 Glucagon signaling pathway
    100665273 (PRKAB2)
   04920 Adipocytokine signaling pathway
    100665273 (PRKAB2)
   04921 Oxytocin signaling pathway
    100665273 (PRKAB2)
  09149 Aging
   04211 Longevity regulating pathway
    100665273 (PRKAB2)
   04213 Longevity regulating pathway - multiple species
    100665273 (PRKAB2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100665273 (PRKAB2)
   04714 Thermogenesis
    100665273 (PRKAB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100665273 (PRKAB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100665273 (PRKAB2)
   04931 Insulin resistance
    100665273 (PRKAB2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 100665273
NCBI-ProteinID: XP_010599609
UniProt: G3U405
LinkDB
Position
Unknown
AA seq 272 aa
MGNTTSDRVSGERHGTKAARAEGAGSHASGKEHKIMVGSTDDPSVFSLQDSKLPGDKEFV
SWQQDLEDAVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggaaacaccaccagcgaccgggtgtccggggagcgccacggcaccaaggctgcgcgt
gccgagggtgccggcagccatgcctcgggcaaggagcacaagatcatggtcgggagcacc
gatgaccccagcgtcttcagcctgcaggactccaagctccctggggacaaagagtttgta
tcatggcagcaagatctggaggacgctgtaaagcccacacagcaggcgcggcccactgtc
atccgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagt
accaagattccactgattaagagccataatgactttgttgccatcctggaccttcctgag
ggagagcaccagtataagttcttcgtggatggacagtgggttcatgatccatcagagcct
gtggttaccagtcagcttggcacaattaataatttgatccatgtcaagaaatcggatttt
gaggtgtttgatgctttaaagctagattctatggaaagctcagagacatcttgccgagac
ctttccagctcacctccagggccttatggtcaagaaatgtatgtgtttcgatctgaggag
cgattcaagtccccgcccatccttcctcctcaccttctccaagttattcttaacaaggac
actaacatttcttgtgaccccgccttgctcccggagcccaaccatgttatgctgaaccat
ctctatgcgttgtccattaaggacagtgtgatggtccttagtgctactcatcgctataag
aagaagtatgtcactacgctgctgtacaagcccatctga

KEGG   Loxodonta africana (African savanna elephant): 100669727
Entry
100669727         CDS       T04351                                 

Gene name
PRKAG1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1 isoform X2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04710  Circadian rhythm
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100669727 (PRKAG1)
   04068 FoxO signaling pathway
    100669727 (PRKAG1)
   04152 AMPK signaling pathway
    100669727 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100669727 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100669727 (PRKAG1)
   04922 Glucagon signaling pathway
    100669727 (PRKAG1)
   04920 Adipocytokine signaling pathway
    100669727 (PRKAG1)
   04921 Oxytocin signaling pathway
    100669727 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    100669727 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    100669727 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100669727 (PRKAG1)
   04714 Thermogenesis
    100669727 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100669727 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100669727 (PRKAG1)
   04931 Insulin resistance
    100669727 (PRKAG1)
SSDB
Motif
Pfam: CBS Cbl_N3 DUF2497
Other DBs
NCBI-GeneID: 100669727
NCBI-ProteinID: XP_010594644
LinkDB
Position
Unknown
AA seq 331 aa
METVAYSDSSLALESEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
AEFPKPEFMCKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP
NT seq 996 nt   +upstreamnt  +downstreamnt
atggagacggttgcttactcagatagctccctagctctggaaagtgagcatcctcaagaa
accccagaatccaacaatagcgtgtatacttccttcatgaagtctcatcgctgctatgac
ctgattcccacaagctccaaattggttgtatttgatacttccctgcaggtgaagaaagct
ttctttgccttggtgactaatggtgtacgagctgcccctttgtgggacagtaagaagcaa
agttttgtgggcatgctgaccatcactgatttcatcaatatcctgcaccgatactataaa
tcagccttggtgcagatctatgagctagaagagcacaagatagaaacttggagagaggta
tacctacaggactcctttaaaccacttgtctgcatttctcctaatgccagcttgtttgat
gctgtctcttcattaattcgaaacaagatccacaggctgccagttattgacccagaatca
ggcaacaccttgtacatcctcacccacaagcgtatcctcaagttcctcaaattgttcatc
gctgagtttcccaagccagagttcatgtgtaagtctctggaagaactgcagattggcact
tatgccaacattgccatggtccgtaccaccacccccgtctatgtggctctgggcatcttt
gtacagcaccgagtttctgctctgccagtggtggatgagaaagggcgtgtggtggacatc
tactccaagtttgatgttatcaatttggctgcagaaaagacctataacaacctagatgtc
tctgtaaccaaagccctgcaacatcgatcacactattttgagggtgtcctcaagtgctac
ctacatgagactctggagaccatcatcaataggctggtggaagcagaggttcaccgactt
gtggtggtggatgagaatgatgtggtcaagggaattgtatctctgtctgacatcctgcag
gccctggtgctcacaggtggagagaagaagccctga

KEGG   Loxodonta africana (African savanna elephant): 100671280
Entry
100671280         CDS       T04351                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04710  Circadian rhythm
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav05410  Hypertrophic cardiomyopathy
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100671280 (PRKAA2)
   04068 FoxO signaling pathway
    100671280 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    100671280 (PRKAA2)
   04152 AMPK signaling pathway
    100671280 (PRKAA2)
   04150 mTOR signaling pathway
    100671280 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100671280 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100671280 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100671280 (PRKAA2)
   04922 Glucagon signaling pathway
    100671280 (PRKAA2)
   04920 Adipocytokine signaling pathway
    100671280 (PRKAA2)
   04921 Oxytocin signaling pathway
    100671280 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    100671280 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    100671280 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100671280 (PRKAA2)
   04714 Thermogenesis
    100671280 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100671280 (PRKAA2)
   05410 Hypertrophic cardiomyopathy
    100671280 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100671280 (PRKAA2)
   04931 Insulin resistance
    100671280 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100671280 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100671280 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100671280 (PRKAA2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100671280 (PRKAA2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100671280 (PRKAA2)
Membrane trafficking [BR:lav04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100671280 (PRKAA2)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100671280 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    100671280 (PRKAA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 100671280
NCBI-ProteinID: XP_003411103
UniProt: G3TA29
LinkDB
Position
Unknown
AA seq 552 aa
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPTYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLVIDNRRIMNQASEFYLASSPPTGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKPLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVMEQR
SGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSFTGSPSGSTLSSVPPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgatgggcgggtgaagatcggacactacgtgctcggggac
acgctgggcgtcggcaccttcggcaaagtgaagattggagaacatcaactgacaggccac
aaagtagcagttaaaatcttaaatagacagaagattcgcagtttggatgttgttggaaaa
ataaaacgagaaattcaaaatctgaaactcttccgacatcctcatattatcaaactatac
caggtgatcagcacaccaacggacttttttatggtaatggagtatgtatctggtggtgaa
ttatttgactacatctgtaaacatggacgggttgaagagatggaagccagacgactcttt
cagcagattctgtctgctgtggattactgtcataggcatatggttgttcatcgagacctg
aaaccagagaatgtgctcttggatgcacacatgaatgccaagatagctgattttggatta
tctaatatgatgtcagatggtgaatttctgcgaactagttgtggatctccaaattatgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaagttgacatctggagctgc
ggtgttattttgtatgctcttctttgtggcaccctcccatttgatgatgagcacgtacct
acattatttaagaagatccgagggggtgttttttatattccagaatatctcaatcgttct
gttgccactctcctgatgcatatgctgcaggttgatcctctgaaacgagcaaccatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccacttacttatttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttatatagcggtgaccctcaagaccagctt
gcagtggcttaccatcttgtcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaactggttcgtttatggatgatagtgccatgcatattccc
ccaggactgaaacctcatccagaaaggatgccacctcttatagcagacagccccaaagca
agatgcccattggacgcgctgaatacgacaaagcccaaacctttagctgtgaaaaaagcc
aagtggcatcttggaattcgaagtcagagcaaaccttatgacattatggctgaagtttac
cgagctatgaagcagctggattttgaatggaaggtggtgaatgcatatcatcttcgtgta
agaagaaagaatccggtgactggcaactatgtgaaaatgagcttacagctttacctggtt
gacaacagaagctatcttttggattttaaaagcatcgatgatgaagtgatggaacagagg
tctggttcctcaacacctcagcgttcctgttctgctgctggcttacatagaccaaggtca
agttttgattccacaactgcagagagccattcactttctggctctttcactggttccccc
agtgggagcacactgtcttcagttccacctcgcctgggcagtcacaccatggattttttt
gaaatgtgtgccagtctgatcactactttagcccgttga

KEGG   Loxodonta africana (African savanna elephant): 100672035
Entry
100672035         CDS       T04351                                 

Gene name
PRKAG2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04710  Circadian rhythm
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100672035 (PRKAG2)
   04068 FoxO signaling pathway
    100672035 (PRKAG2)
   04152 AMPK signaling pathway
    100672035 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100672035 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100672035 (PRKAG2)
   04922 Glucagon signaling pathway
    100672035 (PRKAG2)
   04920 Adipocytokine signaling pathway
    100672035 (PRKAG2)
   04921 Oxytocin signaling pathway
    100672035 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    100672035 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    100672035 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100672035 (PRKAG2)
   04714 Thermogenesis
    100672035 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100672035 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100672035 (PRKAG2)
   04931 Insulin resistance
    100672035 (PRKAG2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 100672035
NCBI-ProteinID: XP_023403820
LinkDB
Position
Unknown
AA seq 308 aa
MRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTIT
DFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNK
IHRLPVIDPLSGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHP
DTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHR
SQYFEGVVKCNKLETLETIVDRIVRAEVHRLVVVSEADSIVGIISLSDILQALILTPAGA
KQKETEAE
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcgattcatgaggtcacacaagtgttatgacattgttccaaccagttcaaagcttgtt
gtctttgatactacattacaagttaaaaaggccttctttgccttggtagccaacggtgtt
cgagcagcgccactgtgggagagtaaaaagcaaagttttgtaggaatgctaacaattaca
gatttcataaacatactccatagatactacaaatcgcccatggtacagatttatgaatta
gaggaacataagattgaaacatggagggagctttatttacaagaaacgtttaaaccttta
gtgaatatatctccagatgcaagcctcttcgatgctgtatactcgttgatcaaaaataaa
atccacagattgccagttattgaccctctcagtgggaatgcactttatatacttacccac
aaaagaatcctcaagtttctccagctttttatgtctgatatgccaaagcctgccttcatg
aagcagaacctggatgagcttggaataggaacataccacaacattgcctttatacatcca
gacactcccatcattaaagccttgaatatatttgtagaaagacgaatatcagcgttgccc
gttgtggatgagtcaggaaaagttgtagatatttattccaaatttgatgtaattaatctt
gctgctgaaaaaacatacaataacctagatatcacagtgacccaggccctgcagcaccgg
tcacagtattttgaaggcgtcgtgaagtgcaataagctggaaacactggagaccatcgtg
gacaggatagtgagggctgaggttcatcggctggtggtagtcagtgaagcagatagtatt
gtgggtattatttccctgtccgacatcctccaagccctgatactcacaccagcaggtgcc
aaacagaaggagacagaagccgagtga

KEGG   Loxodonta africana (African savanna elephant): 100675348
Entry
100675348         CDS       T04351                                 

Gene name
PRKAG3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04710  Circadian rhythm
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100675348 (PRKAG3)
   04068 FoxO signaling pathway
    100675348 (PRKAG3)
   04152 AMPK signaling pathway
    100675348 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100675348 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100675348 (PRKAG3)
   04922 Glucagon signaling pathway
    100675348 (PRKAG3)
   04920 Adipocytokine signaling pathway
    100675348 (PRKAG3)
   04921 Oxytocin signaling pathway
    100675348 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    100675348 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    100675348 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100675348 (PRKAG3)
   04714 Thermogenesis
    100675348 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100675348 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100675348 (PRKAG3)
   04931 Insulin resistance
    100675348 (PRKAG3)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 100675348
NCBI-ProteinID: XP_010600273
LinkDB
Position
Unknown
AA seq 465 aa
MSFLGQGDSASWSSPTMTTRSERTCGKQGAKASKWTRQEVVEEGELPGLGKGFRSRPAAE
STKPEATFPKATPLAQAAPLACPGTPPTGWDLLPPGCAISAGGSSTDDLALNIEFPATPD
GGYELERLVEDRPSPCSSPKFLLPKMGWDDELRKPGAQVYMHFMQEHTCYDAMATSSKLV
IFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSPLVQIYEI
EEHKIETWREIYLQGCFKPLVSISPNDSLLEAVYVLIKNRIHRLPVLDPVSGTVLHILTH
KRLLKFLHIFGTLLPPPSFLSRTIQDLGIGTFRDLAVVLETAPLLTALDIFVDRRVSALP
VINESGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTQCLEGVLSCQPHESFGEVI
DRIVREQVHRLVLVDETQHLLGVVSLSDILQALVLSPAGIDALGA
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgagcttcctagggcaaggagatagtgcctcatggtcatcacccaccatgaccaccagg
tcagaaagaacctgtgggaaacagggggccaaggcctccaaatggacaaggcaggaggtt
gtggaggaaggggagctgccaggcctggggaaaggtttccgatccaggccagctgctgaa
tccaccaagccagaggccacattccccaaggccacacccttggcccaagctgctcccctg
gcctgcccaggcaccccgccaacagggtgggacctcctgccccctggctgtgccatctca
gctgggggctccagcacagatgatctggcgctgaacatagagttcccagccacaccagac
ggtggatatgagctcgaacgcctagtggaagacaggccctccccatgctcatccccaaag
tttctgctgcccaagatgggctgggacgacgaacttcggaagcccggggcccaggtctac
atgcacttcatgcaggagcacacctgctatgatgccatggcaaccagctccaagctggtc
atctttgacaccatgctggagatcaagaaggccttttttgccctggtggccaacggcgtg
cgggcagcacctctgtgggacagcaagaagcagagctttgtggggatgctgaccatcaca
gacttcatcttggtcctgcaccgctactacaggtcccccctggtccagatctatgagatt
gaagaacataagatcgagacctggagggagatctacctgcaaggctgcttcaagcctctg
gtctccatctctcccaatgatagcctgttagaagccgtctatgtcctcatcaagaaccgg
attcatcgcctgcctgtcctggacccagtttcaggcactgtgctccacattctcacccac
aagcggctgcttaagttcctgcacatctttggcaccctgctgcccccgccctccttcctc
tcccgcactatccaagatttgggcatcggcacattccgagacttggctgtggtgctggaa
acggcccccctcctgactgcactggacatttttgtggaccggcgtgtgtctgcactgcct
gtgatcaatgaatctggtcaggtcgtgggcctctactcccgcttcgatgtgattcacctg
gctgcccagcaaacctacaaccacctagacatgagtgtgggagaagccctgaggcagagg
acacagtgtctggagggagtcctttcctgccagccccacgagagctttggagaagtcatt
gacaggattgtccgggagcaggtacaccggctggtgctagtggatgaaacccagcatctc
ttgggcgtggtctccctctccgacatccttcaggcactggtactcagccctgctggcatc
gatgcccttggtgcctaa

KEGG   Loxodonta africana (African savanna elephant): 100676546
Entry
100676546         CDS       T04351                                 

Gene name
PRKAB1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04710  Circadian rhythm
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100676546 (PRKAB1)
   04068 FoxO signaling pathway
    100676546 (PRKAB1)
   04152 AMPK signaling pathway
    100676546 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100676546 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100676546 (PRKAB1)
   04922 Glucagon signaling pathway
    100676546 (PRKAB1)
   04920 Adipocytokine signaling pathway
    100676546 (PRKAB1)
   04921 Oxytocin signaling pathway
    100676546 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    100676546 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    100676546 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100676546 (PRKAB1)
   04714 Thermogenesis
    100676546 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100676546 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100676546 (PRKAB1)
   04931 Insulin resistance
    100676546 (PRKAB1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 100676546
NCBI-ProteinID: XP_010597239
UniProt: G3SWG7
LinkDB
Position
Unknown
AA seq 270 aa
MGNTSSERAALERQGGHKTPRRDSSGGAKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFLVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYICKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcaacacgagcagcgagcgcgccgcgctggagcggcagggtggccataagacgccc
cggagggacagctctgggggcgccaaggacggggacaggcccaagatcctgatggatagc
cccgaggacgccgacctctttcactccgaggaaatcaaggctccagagaaggaggaattc
ctggcctggcagcatgatctggaagtcaacgataaagctcctgcccaggctcggccaact
gtatttcggtggacagggggcggaaaggaagtttatttgtctgggtccttcaacaactgg
agtaaacttcccctcacaagaagccacaacaactttgtagccatcttggatctacctgaa
ggggagcatcagtacaagttccttgtggacggccagtggacacatgacccttctgagcca
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctgtcc
agttcaccgccaggaccctaccaccaggagccctacatctgcaaacccgaagagcggttt
aaagcgccccccatcctcccgccacatctgctccaggtcatcctgaacaaggacacaggg
atttcgtgcgatccagccttgctccctgagcccaatcacgtcatgttgaaccacctctat
gctctttctatcaaggatggagtgatggtgctcagcgcgacccaccggtacaagaaaaag
tacgtcaccaccttgctttacaagcccatatga

DBGET integrated database retrieval system