KEGG   Loxodonta africana (African savanna elephant): 100659451
Entry
100659451         CDS       T04351                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04115  p53 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04218  Cellular senescence
lav04934  Cushing syndrome
lav05161  Hepatitis B
lav05162  Measles
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05206  MicroRNAs in cancer
lav05215  Prostate cancer
lav05222  Small cell lung cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100659451 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100659451 (CCNE1)
   04114 Oocyte meiosis
    100659451 (CCNE1)
   04115 p53 signaling pathway
    100659451 (CCNE1)
   04218 Cellular senescence
    100659451 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659451 (CCNE1)
   05206 MicroRNAs in cancer
    100659451 (CCNE1)
   05203 Viral carcinogenesis
    100659451 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100659451 (CCNE1)
   05215 Prostate cancer
    100659451 (CCNE1)
   05222 Small cell lung cancer
    100659451 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100659451 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100659451 (CCNE1)
   05161 Hepatitis B
    100659451 (CCNE1)
   05162 Measles
    100659451 (CCNE1)
   05169 Epstein-Barr virus infection
    100659451 (CCNE1)
   05165 Human papillomavirus infection
    100659451 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100659451 (CCNE1)
   03036 Chromosome and associated proteins [BR:lav03036]
    100659451 (CCNE1)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100659451 (CCNE1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100659451 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100659451
NCBI-ProteinID: XP_010594427
LinkDB
Position
Unknown
AA seq 395 aa
MKEDGSSDLSARSRKRKANVAVFLQDPDEEVATIERTVRSQCGSQPWDSNAACANPCSLI
PTPDKEEGELAYPHSAYEPPSFAPTRASPLPVLNWANRDEVWNIMLNKEKTYLRDKHVMQ
RHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQQNVVKTLLQLIGISS
LFIAAKLEEIYPPKLHQFAYVTDGACSGDDILNMELGIMKALKWRLSPLTVVSWLNVYMQ
VAYLKDFYEVLLPQYPQQIFIQIAELLDLCILDVGCLEFSYGVLAASALYHFSSSELMQK
VSGYQWCEIERCVKWMVPFAMVIRETGSSKLKHFRGIPAEDAHNIQTHVNSLDLLDKAQA
KKAILSEQNRVSPLPTGVLTPPQSGKKQGGEQETA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaaggaggacggcagcagcgatctctctgctcgctccaggaaaaggaaggcaaatgtg
gccgtttttttgcaggatccagatgaagaagtcgccacaattgagaggactgtgagaagc
cagtgtggcagtcagccttgggacagtaatgcagcctgtgcaaacccctgctccctgatc
ccgacacctgacaaagaggagggtgagctggcatacccacattccgcctacgaacctccg
agtttcgcgccaacgagagcctcaccactgccagttctgaactgggcaaatagagacgaa
gtgtggaatatcatgctaaacaaagaaaagacctacttgagggataagcacgtcatgcag
aggcaccctcttctgcagccgaagatgcgcgccatccttctggactggctcatggaggtg
tgtgaagtgtataaacttcacagggagacattttacttggcacaagatttctttgatcgg
tatatggcaacacaacagaacgttgtaaaaacgcttctacagcttattgggatttcatct
ttatttattgcagccaaacttgaggaaatctatcctcccaagttgcaccagtttgcatat
gttacagacggggcttgttcaggagatgacattctcaacatggaattaggcattatgaag
gccctgaagtggcgtttaagtcccctgacagttgtgtcctggctgaatgtatacatgcaa
gttgcatatctaaaggacttttatgaagtgctgttgccgcagtatccccagcaaatcttc
atacagattgcagagcttttagatctctgcatcctggatgttggctgcttagaattttct
tatggcgtgctcgctgcttccgccttgtatcatttctcttcgtctgaattgatgcaaaag
gtttcagggtaccagtggtgtgagatagagaggtgtgtcaagtggatggtccccttcgcc
atggtcatcagggagacgggaagttcaaaactgaagcacttcaggggcattcctgctgaa
gatgctcacaacatccagacccatgtcaacagcttggatttgctggacaaggcccaagca
aagaaagccatattgtctgaacaaaatagggtttctcctctccccactggggtcctcacg
cccccacagagcggtaagaagcagggcggtgagcaggagacagcgtga

KEGG   Loxodonta africana (African savanna elephant): 100668342
Entry
100668342         CDS       T04351                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04115  p53 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04218  Cellular senescence
lav04934  Cushing syndrome
lav05161  Hepatitis B
lav05162  Measles
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05206  MicroRNAs in cancer
lav05215  Prostate cancer
lav05222  Small cell lung cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100668342 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100668342 (CCNE2)
   04114 Oocyte meiosis
    100668342 (CCNE2)
   04115 p53 signaling pathway
    100668342 (CCNE2)
   04218 Cellular senescence
    100668342 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668342 (CCNE2)
   05206 MicroRNAs in cancer
    100668342 (CCNE2)
   05203 Viral carcinogenesis
    100668342 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100668342 (CCNE2)
   05215 Prostate cancer
    100668342 (CCNE2)
   05222 Small cell lung cancer
    100668342 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100668342 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100668342 (CCNE2)
   05161 Hepatitis B
    100668342 (CCNE2)
   05162 Measles
    100668342 (CCNE2)
   05169 Epstein-Barr virus infection
    100668342 (CCNE2)
   05165 Human papillomavirus infection
    100668342 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100668342 (CCNE2)
   03036 Chromosome and associated proteins [BR:lav03036]
    100668342 (CCNE2)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100668342 (CCNE2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100668342 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100668342
NCBI-ProteinID: XP_003408444
UniProt: G3SNP2
LinkDB
Position
Unknown
AA seq 404 aa
MSRRSSRLQAKQQPQPSQTDSPQEAQVIQAKKRKTTQDVKKRKEEVTKKHQYEIRNCWPP
ILSGGISPCVIIETPHKETVTSDFSRFTNYRFKNLFINPSPLPDLSWGCSNEVWHNMLKK
ETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDV
NKNMLQLVGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELFILKALKWELCP
VTIISWLNLFLQVDALKDAPKVLLPQYSQEKFIQVAQLLDLCILAIDSLEFQYRVLAAAA
LCHFTSIEVVKKASGLEWDNISECVDWMVPFVNVIKGTSPVKLKAFKKVPVEDRHNIQTH
SNYLVMLDEVNYINNFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcagcagccccaacccagccagacggat
tcccctcaagaagcccaggtaatccaggccaagaagagaaaaacaacccaggatgtcaaa
aaaagaaaagaggaggtcaccaagaaacatcagtatgagattaggaattgttggccacct
atattatctgggggcatcagtccttgcgttatcattgaaacaccccacaaagaaacagta
acaagtgacttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagctggggatgttccaatgaagtttggcataatatgttgaaaaaa
gagaccagatatgttcatgacaagcattttgaagttctgcattctgacttggaaccacag
atgaggtcaatacttctagactggcttttagaggtatgcgaagtatacacacttcatagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatgta
aataaaaatatgcttcaactcgttggaattacctctttattcattgcttccaaacttgag
gaaatctacgctcctaagctccaagagtttgcttatgtcactgacggtgcttgcagtgaa
gaggatatcttaaggatggaactctttatattaaaggctttaaaatgggaactttgtcct
gtaacaatcatctcttggctaaatctctttctccaagtcgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaaagttcatccaggtagctcagcttttagat
ctgtgtattctagccatcgattcattagagttccagtacagagtattggctgctgctgcc
ttgtgccattttacctctattgaagtggttaagaaagcctcaggtttggaatgggacaac
atttctgaatgtgtagactggatggtgccttttgtcaatgtaataaaaggtactagtcca
gtgaagctgaaggcttttaagaaggttcctgtggaagatagacacaacatccagacacat
tcaaattatctagttatgttggatgaagtaaattatataaacaacttcagaaaaggggga
cagctgtcaccagtgtgcaatggaggcatcatgacaccgccgaagagcaccgaaaaacca
ccaggaaaacactaa

DBGET integrated database retrieval system