KEGG   Loxodonta africana (African savanna elephant): 100659930
Entry
100659930         CDS       T04351                                 

Gene name
LPO
Definition
(RefSeq) LOW QUALITY PROTEIN: lactoperoxidase
  KO
K12550  lactoperoxidase [EC:1.11.1.7]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100659930 (LPO)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     100659930 (LPO)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 100659930
NCBI-ProteinID: XP_003414645
LinkDB
Position
Unknown
AA seq 719 aa
MNLGFISVMSLLLHLPALLASLALLQATVSATCAQTTIAAAISDAVSQVKVQVDKAFLDS
RTRLKTSMSSESPTMRQLLEYLKHAKGQTRMAIRKGQVWEETLKRLTQSLTLTNVTGPSL
HLAFLFHEVGCGLPASAVICNKYSPYRTITGDCNNRRNTELGAANRALARWLPAEYEDGL
SLPFGWTPGKTRNGFPLPLAREVSNQIVGYLNGDVLDQKRSLVFMQWGQIVDHDLDFAPE
TELGSSQHSQTQCDEHCIQGDNCFPIMFPPNDPKVKTQGKCMPFIRSGFVCPTPPYESLT
RDQINAPTSFLDASFVYGSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPFVSKKPNP
CEFINTTARVPCFLAGDSRASEQILLAASHTLFLREHNRLARELKELNPHWDGEMLYQET
RKILGAFTQIITFRDYLPIVLGDEMQKKIPPYQGYNESVDPRISNVFTLAFRFGHLEIPS
TMSRLDKNYQPWGPESELPLHTLFFNTWRIVKDGGIDPLVRGMLARKSKLMHQNKMMTGE
LRNKLFQPPHNIYGHDLAAINIQRSRDHGLPGYNSWRGFCGLSQPKTMEELNTVLENEML
AKKLLDLYGTPDNIDVWMGAIAEPMVEGGRVGSLLACLMGKQFQKVRDGDRFWWENPGVF
TKKQQEALQKVSVSRLICDNTHITKVPLDPFQANSYPQDFVDCSAIDKLDLSPWASVEN
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaacctgggtttcatttcagtgatgagcctccttctccatctcccagccctcctggca
tctctggccttgctccaggctacagtgtctgccacatgtgcacagaccaccatagctgct
gccatctctgatgctgtgagtcaggtcaaggtccaagtcgacaaggccttcttggattcc
cgaaccaggctgaagacttccatgagctctgagtctcccaccatgcgacagctcttagaa
tatctcaagcatgccaaaggccagactcgcatggccatccgcaaagggcaggtgtgggag
gagaccttaaagagactgactcagagcttgaccttgaccaatgtcacaggccccagcctg
cacttggctttcctctttcatgaagtgggatgtggtctccctgcctctgcagtgatatgc
aacaagtacagcccttatcgcaccattacaggagactgtaataacaggaggaacaccgag
ctgggagctgccaacagggcgctggcgcgctggctgccggccgagtacgaggacgggctc
tccctcccctttgggtggacgccgggaaagacgcggaacggctttcctctcccgctggcc
agagaggtatccaaccagatcgttggctatctgaacggggacgttctggatcaaaaaaga
tccctggtcttcatgcagtggggccaaattgtggaccacgacctggactttgcccctgag
actgagttggggagtagccagcactcccaaacccagtgtgacgaacactgtatccaaggg
gacaactgtttccccatcatgttcccgcccaacgaccccaaggtgaagactcaagggaag
tgcatgccgttcatccgatctgggtttgtctgccctactccaccctacgagtccctgacc
cgagatcagatcaatgctcccacctccttcctggatgccagctttgtgtatgggtcggag
ccgagtctggccagccgcctccgcaacctcagcagccccctgggcctcatggccgtcaac
caggaggtctcggaccatgggctcccctacctgccctttgtcagcaagaagccaaacccc
tgcgaattcatcaacaccacggcccgagtgccctgcttcctggcgggagattcccgagcc
tcagagcagatcctgctggccgcttcccacaccctcttcctccgagagcacaaccggctg
gccagagaactaaaggaactcaatcctcattgggatggagagatgctctaccaggaaacc
cggaaaatcctgggagccttcacacagattatcacctttagggactacctgcccattgtg
ctgggtgatgaaatgcagaagaagatccctccataccaaggctacaatgaatctgtggat
ccccgaatttccaatgtcttcacccttgccttccgctttggccacttagagattccctct
actatgtcccgcctggataagaactatcagccatggggcccagagtcagagctccccctg
cataccctcttcttcaacacctggagaatagtcaaagacggtggaattgaccctctggta
cggggcatgctggccaggaagtccaagttgatgcatcagaataaaatgatgacaggagag
ctacgcaacaagctcttccagccacctcacaacatttacggccatgacctggctgccatc
aatatacaacggagccgggaccatgggctgcctgggtacaattcctggagaggcttctgt
ggcctctcccagcccaagacaatggaggagctgaacactgtgctggagaatgagatgctg
gctaagaagttactggatctctatgggacccctgacaacatcgatgtctggatgggggcc
attgctgagcccatggtagagggaggccgtgtagggtctctcctggcctgtctcatgggg
aagcagttccagaaggttcgtgacggagacaggttttggtgggagaaccctggggtcttc
accaagaagcagcaggaagctctgcagaaagtgtccgtctcacgcctcatctgtgacaac
acccacatcaccaaggtccctctggacccattccaggccaacagctacccccaggacttt
gtggattgctcagccattgataagctggacctctcaccctgggcctcggtggagaattag

DBGET integrated database retrieval system