KEGG   Loxodonta africana (African savanna elephant): 100660311
Entry
100660311         CDS       T04351                                 

Gene name
ARRB2
Definition
(RefSeq) beta-arrestin-2 isoform X1
  KO
K04439  beta-arrestin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04062  Chemokine signaling pathway
lav04144  Endocytosis
lav04340  Hedgehog signaling pathway
lav04728  Dopaminergic synapse
lav04740  Olfactory transduction
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100660311 (ARRB2)
   04340 Hedgehog signaling pathway
    100660311 (ARRB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100660311 (ARRB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100660311 (ARRB2)
  09152 Endocrine system
   04929 GnRH secretion
    100660311 (ARRB2)
   04926 Relaxin signaling pathway
    100660311 (ARRB2)
   04928 Parathyroid hormone synthesis, secretion and action
    100660311 (ARRB2)
  09156 Nervous system
   04728 Dopaminergic synapse
    100660311 (ARRB2)
  09157 Sensory system
   04740 Olfactory transduction
    100660311 (ARRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100660311 (ARRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100660311 (ARRB2)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    100660311 (ARRB2)
SSDB
Motif
Pfam: Arrestin_C Arrestin_N
Other DBs
NCBI-GeneID: 100660311
NCBI-ProteinID: XP_023412129
LinkDB
Position
Unknown
AA seq 343 aa
MGRSGGIVRLWPWREREEAGNPEPPPFKVLPHSGSLCLAAFSGPPSFFSHPQVEIGRKTG
GLPGGTKALPPLCHRYPRICPALSHCSQAQRTQGRNSVRLVIRKVQFAPEKPGPQPSAET
TRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFST
AQYKCPVAQIEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIV
KEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIITLPRPQSAAPEMD
VPVDTNLIEFDTNYATDDDIVFEDFARLRLKGVKDEDYDDQFC
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgggcagatctggagggatagtaaggctttggccttggcgtgaaagggaggaggcaggg
aaccccgagccacctccttttaaggtcctcccgcattcaggaagcctttgcctcgctgcc
ttctctgggcccccttccttcttttctcacccccaggttgagattgggaggaagactggg
gggcttcccggaggaactaaagccctccctcccctctgccacagataccccagaatctgc
cctgctctgtcacactgcagccaggcccagaggacacagggaaggaactctgtgcggctg
gtgatccgaaaggtgcagtttgcccctgagaaacccggcccccagccttcagctgaaacc
acacgccacttcctcatgtctgaccggtccctgcaccttgaggcgtccctggacaaggag
ctgtactaccacggggagcccctcaatgtcaatgtccacgtcaccaacaactccaccaag
accgtcaagaagatcaaagtctctgtgagacagtatgccgacatctgcctcttcagcacc
gcccagtacaagtgccccgtggctcaaatcgaacaagatgaccaggtatcccccagttcc
acattctgtaaggtatacaccataaccccgctgctcagcgacaaccgggagaagcgtggc
ctcgccctggatgggaaactcaaacacgaggacaccaacctggcttccagcaccatagtg
aaggagggtgccaacaaggaggtgctgggaatcctggtgtcctacagggtcaaggtgaag
ctggtggtgtctcgaggcggggatgtctctgtggagctgccttttgttcttatgcacccc
aaaccccatgaccacatcatcacactccccagaccccagtcagccgctcctgaaatggat
gtccctgtggataccaacctcattgaatttgataccaactacgccacggatgatgacatt
gtgtttgaggactttgccaggcttcggctgaagggggtgaaggatgaggactatgacgac
caattctgctag

KEGG   Loxodonta africana (African savanna elephant): 100665736
Entry
100665736         CDS       T04351                                 

Gene name
ARRB1
Definition
(RefSeq) beta-arrestin-1 isoform X6
  KO
K04439  beta-arrestin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04062  Chemokine signaling pathway
lav04144  Endocytosis
lav04340  Hedgehog signaling pathway
lav04728  Dopaminergic synapse
lav04740  Olfactory transduction
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100665736 (ARRB1)
   04340 Hedgehog signaling pathway
    100665736 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100665736 (ARRB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100665736 (ARRB1)
  09152 Endocrine system
   04929 GnRH secretion
    100665736 (ARRB1)
   04926 Relaxin signaling pathway
    100665736 (ARRB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100665736 (ARRB1)
  09156 Nervous system
   04728 Dopaminergic synapse
    100665736 (ARRB1)
  09157 Sensory system
   04740 Olfactory transduction
    100665736 (ARRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100665736 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100665736 (ARRB1)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    100665736 (ARRB1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C LDB19
Other DBs
NCBI-GeneID: 100665736
NCBI-ProteinID: XP_003420082
UniProt: G3TN00
LinkDB
Position
Unknown
AA seq 418 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTSSPQLNNR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggcgacaaagggacacgagtcttcaagaaggcaagccccaatggaaagctcaccgtc
tatctgggaaagcgggactttgtggaccacattgacctcgtggacccagtggatggtgtg
gtcctggtggatcctgagtatctcaaggagaggagagtctatgtgacactgacctgcgcc
ttccgctatggccgggaggacctggatgtcctgggcctgacctttcgcaaggacctgttt
gtggcgaacgtgcagtccttcccaccggcccccgaggacaagaagcccctgacgcggctg
caggagcgcctcatcaagaagctgggcgagcacgcctaccctttcacctttgagatccct
ccgaacctcccatgctctgtgacactgcagccagggcctgaagacacagggaaggcttgt
ggtgtggactatgaagtcaaagctttctgcgcagagaacctggaggagaagatccacaag
cggaattctgtgcgcctggtcatccggaaggttcagtatgccccggagaggcctggcccc
cagcccacagccgagaccaccaggcaattcctcatgtcggacaagcccttgcacctagag
gcctccctggataaggagatctattaccatggagaacccatcagcgtcaatgttcatgtc
accaacaacaccaacaaaacagtgaagaagatcaagatatcagtgcgccagtatgcggac
atctgccttttcaacacagcccagtacaaatgccctgtggccatggaagaggctgacgac
acagtggcacccagctcaacattctgcaaggtctacacgctgacccccttcctggccaac
aaccgggagaagcggggcctcgccttggacgggaagctcaagcacgaagacaccaacctg
gcctccagcaccctgctgagggaaggagccaaccgggagatcctggggattattgtttcc
tacaaagtgaaagtgaagctggtggtgtcacggggaggcctgttgggagatcttgcatcc
agcgacgtagctgtggaactgcctttcaccctgatgcaccctaagcccaaagaggaaccc
ccacatcgggaagttccagagaacgagacgccagtagataccaatctcatagaacttgac
acaaacgatgacgacattgtatttgaggactttgcccgccagagactgaaaggcatgaaa
gacgacaaggaggaagaggaggacggtaccagctctccacagctcaacaacagatag

DBGET integrated database retrieval system