KEGG   Loxodonta africana (African savanna elephant): 100660517
Entry
100660517         CDS       T04351                                 

Gene name
SCARB1
Definition
(RefSeq) scavenger receptor class B member 1
  KO
K13885  scavenger receptor class B, member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04913  Ovarian steroidogenesis
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav04975  Fat digestion and absorption
lav04976  Bile secretion
lav04977  Vitamin digestion and absorption
lav04979  Cholesterol metabolism
lav05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100660517 (SCARB1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100660517 (SCARB1)
   04925 Aldosterone synthesis and secretion
    100660517 (SCARB1)
   04927 Cortisol synthesis and secretion
    100660517 (SCARB1)
  09154 Digestive system
   04976 Bile secretion
    100660517 (SCARB1)
   04975 Fat digestion and absorption
    100660517 (SCARB1)
   04979 Cholesterol metabolism
    100660517 (SCARB1)
   04977 Vitamin digestion and absorption
    100660517 (SCARB1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100660517 (SCARB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100660517 (SCARB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100660517 (SCARB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100660517 (SCARB1)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    100660517 (SCARB1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100660517 (SCARB1)
SSDB
Motif
Pfam: CD36
Other DBs
NCBI-GeneID: 100660517
NCBI-ProteinID: XP_010598103
LinkDB
Position
Unknown
AA seq 469 aa
MIVLVPSFIEQQVLKNVRIDPSSLSFNMWKEIPVPFYLSVYFFHVVNPDNVLKGEKPQVQ
ERGPYVYREFRHKSNITFNDNDTVSFLEYRTFQFQPAKSYGLESDYIVMPNILVLTAAML
VENQPLSLKVLMSLAFSTLGERAFMNRTVGEIMWGYEDPLMDFINKYFPNLLPFNGKFGL
FSELNNTHSGLFTVFTGVKDFSRIHLVNKWNGLSKVSFWHSDQCNMINGTSGQMWAPFMT
PESSLEFYSPDACRSMKLVYQEAGVFEGIPIYRFVAPPTLFANGSVYPPNEGFCPCLESG
IQNVSTCRFGAPLFLSHPHFYNADPVLAEAVLGLHPNHQEHSLFLDIHPVTGIPMNCSVK
LQLSLYIKAVKGIGQTGSISPVVLPLLWFGESGTMEGQALQTFYTQLVLLPAVLHYAQYV
LLALGCALLLIPVVHLIRSQGRKDATSQPSLAAQPDQLPSPCTPLLKES
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgatcgtcctggtgccctcgttcatcgagcagcaggtcctcaagaatgtgcgcatcgac
cccagtagcctgtccttcaacatgtggaaggagatccctgtcccgttctacctctctgtc
tacttcttccacgtggtcaaccccgacaacgtcctgaagggcgagaagccgcaggtgcag
gagcgtgggccctacgtgtacagggagttcaggcataagagcaacatcaccttcaacgac
aatgacacagtgtccttcctggagtaccggaccttccagttccagcccgccaagtcctat
ggcctggagagtgactacatcgtcatgcccaacatcctggtcctgactgccgccatgttg
gtggagaaccagcccttgagcctgaaggtgctcatgtccttggcattcagcacccttggg
gagcgtgccttcatgaaccgcactgttggggagatcatgtggggctacgaagaccccctc
atggacttcatcaataagtactttccaaacttgctccccttcaatggcaagttcgggtta
ttttcggagctcaacaacacccattctgggctcttcaccgtgttcacaggggtcaaggac
ttcagcaggatccacctggtgaacaagtggaatgggctcagcaaggtcagcttctggcat
tctgaccagtgcaacatgattaatggaacttctggacaaatgtgggcacccttcatgact
cctgaatcctcgctggaattctacagccctgatgcctgccggtccatgaagctggtctac
caggaggcgggggtgtttgaaggcatccccatctaccgcttcgtggccccccctacctta
tttgccaacgggtccgtctacccgcccaatgagggtttctgcccatgcctggagtctggg
atccagaacgtcagcacctgccgctttggtgcacccctgtttctctcccatcctcacttc
tacaacgcggacccagtcttggctgaggcagtgctcggcctccaccctaaccaccaagag
cattccttgttcctggacattcacccggtcactgggatccccatgaactgctccgtgaag
ctgcagctgagcctctacatcaaggccgtcaagggcatcggacaaacggggagcatcagt
cctgtggtcctgcccctgctttggtttggagagagcggcacgatggagggccaggccctg
caaaccttctacacgcagctggtgctgctgcctgcagtgctgcactacgcccagtacgtg
ctcctcgccctgggctgcgccctgctgctcatcccggtcgtccacctgatccggagccag
ggccgcaaagatgccacgagccagcccagcctggcggctcagccagaccagctccccagc
ccctgcaccccacttctaaaggagtcttga

DBGET integrated database retrieval system