KEGG   Loxodonta africana (African savanna elephant): 100660583
Entry
100660583         CDS       T04351                                 

Gene name
NPPB
Definition
(RefSeq) natriuretic peptides B
  KO
K12335  natriuretic peptide B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100660583 (NPPB)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100660583 (NPPB)
  09159 Environmental adaptation
   04714 Thermogenesis
    100660583 (NPPB)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 100660583
NCBI-ProteinID: XP_023408255
LinkDB
Position
Unknown
AA seq 159 aa
MDQTALTRALLLLLFLHLSPPGGHSHPLGGPDLDLELPGLQKLLDHLQDTVSEVQTEPVI
LEPVQQGRSPVEAGEAQEVTVSEVQTEPVILEPLQQGHGPVEAGEAQEVSPMGVPQPQIP
EAQGRLPSPKTMSDSGCFGGKMDRIGFHSRLRCNVLGSP
NT seq 480 nt   +upstreamnt  +downstreamnt
atggaccagaccgcgctgacccgggcacttctgctcctcctgttcctgcacctgtcgcct
ccgggaggtcattcccaccctctaggtggccctgacctggacttggaactgcccgggtta
cagaagctgttggaccatttgcaggacacggtctctgaggtgcagacggagccagtgatc
ctggagcccgtccagcagggccgtagccctgtcgaagccggggaggcccaggaggtcacg
gtctctgaggtgcagacggagccagtgatcctggagcccctccagcagggccatggccct
gtcgaagccggggaggcccaggaggtatcccccatgggtgtcccccagcctcaaatccct
gaggcccaggggagactacccagccccaagacgatgagtgattctggctgctttgggggg
aagatggaccgcattggcttccacagccgcctgcgttgcaatgtgctggggagcccttaa

DBGET integrated database retrieval system