KEGG   Loxodonta africana (African savanna elephant): 100661902Help
Entry
100661902         CDS       T04351                                 

Definition
(RefSeq) alpha-amylase 2B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00500  Starch and sucrose metabolism
lav01100  Metabolic pathways
lav04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100661902
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100661902
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100661902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Motif
Other DBs
NCBI-GeneID: 100661902
NCBI-ProteinID: XP_003409577
UniProt: G3UDW9
LinkDB All DBs
Position
Unknown
AA seq 511 aa AA seqDB search
MKFFLLLLAVGFCWAQYSPHTESGRTSIVHLFEWRWADIALECERYLAPKGFGGVQVSPP
NENAVINNPSRPWWERYQPVSYKICTRSGNENEFKDMVTRCNNVGVRIYVDAVINHMSGS
GVSAGTSSTCGSYFDPGSRDFPAVPYSGWDFNDGKCKTESGEIENYQDATQVRDCRLVGL
VDLALGKDYVRSKIAEYLNNLIDIGVAGFRIDASKHMWPGDIKAILDTLNNLNTRWFSEG
SRAFIYQEVIDLGGEPITGSEYFGNGRVTEFKYGAKLGTVLRKWNGEKMSYLNNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFFDARLYKMGVGFMLAHPYGFTRVMSSYRWD
RNFVNGQDANDWIGPPNNDGVIKEVTINPDTTCGNGWVCEHRWRQIRNMVAFRNVVDGQP
FTNWWDNGSNQVAFGRGNKGFIVFNNDDWSLSVTLQTGLPAGTYCDVISGDKSDGNCTGI
KIYVSSDGKANFSISNSAEDPFIAIHADSKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctattacttttagctgttgggttctgctgggctcagtatagcccacat
actgaatctgggcgaacatctattgttcacctgtttgagtggcgctgggctgatattgcc
cttgaatgtgaacgatacttagctcccaaaggatttggaggcgttcaggtttctccaccc
aatgaaaatgctgtaatcaataacccttcaagaccttggtgggaaagataccaaccagtc
agctacaagatatgcacgagatctggaaatgaaaatgaattcaaagatatggtgactaga
tgcaacaacgttggtgtccgtatttacgtggatgctgtaattaatcatatgagtggaagt
ggcgtgagtgcaggaacaagcagtacttgtggaagttacttcgaccctggaagtagggat
tttccagcagtcccatactctggttgggattttaatgatggtaaatgtaaaactgaaagt
ggagaaattgagaactatcaagatgctactcaggtcagagattgtcgtctggttggtctt
gttgatcttgcattggggaaagattatgtgcggtccaagattgctgaatatctgaacaac
ctcattgacattggtgtggcaggattccgaattgatgcttccaagcacatgtggcctgga
gacataaaggctattttggatacactgaataatctaaacacacgctggttctccgaagga
agtcgagctttcatttaccaggaggtaattgatctgggtggtgaaccaattacaggcagt
gagtactttggaaatggccgtgtgacagaattcaagtatggtgcaaaactaggcacagtt
ctgcgcaagtggaatggagagaaaatgtcttacttaaacaactggggcgagggctggggt
tttgtgccttctgacagagcacttgtctttgtggataaccatgacaatcagcgaggacat
ggagctggcggagcatctattcttacattctttgatgctagactgtataaaatgggagtt
ggatttatgcttgctcatccttatggctttacacgagtaatgtcaagctaccgttgggac
agaaactttgtgaacggacaagatgctaatgattggattgggccaccaaataatgatgga
gtaattaaagaagttacaattaacccagacactacttgtggcaatggctgggtctgtgaa
catcgatggcgtcaaataaggaacatggttgctttccgaaatgtggttgatggccagcct
tttacaaattggtgggataatggaagcaaccaagtggcctttggaaggggaaacaaaggg
tttattgtctttaacaatgatgactggtcattatctgtaactttgcaaactggtcttcct
gctggcacatattgtgatgtcatttctggagataaaagtgacggcaactgcacaggaatt
aaaatctatgtttccagtgatggcaaagctaacttttccatcagcaactctgctgaggat
ccatttattgcaattcatgctgactccaagttatga

DBGET integrated database retrieval system