KEGG   Loxodonta africana (African savanna elephant): 100662321
Entry
100662321         CDS       T04351                                 

Gene name
RAD51
Definition
(RefSeq) DNA repair protein RAD51 homolog 1
  KO
K04482  DNA repair protein RAD51
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03440  Homologous recombination
lav03460  Fanconi anemia pathway
lav05200  Pathways in cancer
lav05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100662321 (RAD51)
   03460 Fanconi anemia pathway
    100662321 (RAD51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662321 (RAD51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100662321 (RAD51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100662321 (RAD51)
   04121 Ubiquitin system [BR:lav04121]
    100662321 (RAD51)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100662321 (RAD51)
Membrane trafficking [BR:lav04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100662321 (RAD51)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    100662321 (RAD51)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     100662321 (RAD51)
    RecA family proteins
     100662321 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100662321 (RAD51)
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase HhH-GPD HHH ssDNA_TraI_N
Other DBs
NCBI-GeneID: 100662321
NCBI-ProteinID: XP_003418703
UniProt: G3T2F7
LinkDB
Position
Unknown
AA seq 339 aa
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcaatgcagatgcagcttgaggcaaatgcagatacttcagtggaagaagaaagcttt
ggcccacaacctatctcacggttagagcagtgtggcataaatgccaatgatgtgaagaaa
ctagaagaagctggattccatactgttgaggctgttgcctatgcaccgaagaaggagcta
ataaatattaaaggtattagtgaagccaaagctgataaaattttggcagaggcagctaaa
ttagttcccatgggtttcaccactgcaactgaattccaccagaggcgctcagagatcata
cagattactactggctccaaagagcttgacaaactacttcaaggtggaatcgagactgga
tccatcacagagatgtttggggagtttcgaactgggaagacccagatctgtcatacactg
gctgttacgtgtcagcttcctattgaccggggtggaggtgaaggaaaggccatgtacatt
gacaccgagggtacctttaggcccgaacggctgctggcagtggctgagagatatggcctc
tctggcagtgatgtcctggataatgtagcatacgctcgagggttcaacacagaccaccag
acccagctcctttatcaagcatcagccatgatggtggagtccaggtacgcgctgctgatt
gtagacagtgccactgccctctacagaacagactactctggtcgcggtgaactctcagcc
aggcagatgcacttggccaggtttctgcggatgcttctgcgacttgctgacgagtttggt
gtggccgtggtaatcactaaccaggtggtagcccaagtggatggagcagccatgtttgct
gcagaccccaagaaacctattggaggaaacatcattgcccatgcttcaacaaccagactg
tacctgaggaaaggaagaggagaaacgagaatctgcaagatctatgactctccctgtctt
ccggaagctgaagctatgtttgccatcaacgcagatggagtgggagacgccaaagactga

DBGET integrated database retrieval system