KEGG   Loxodonta africana (African savanna elephant): 100663115
Entry
100663115         CDS       T04351                                 

Definition
(RefSeq) transient receptor potential cation channel subfamily V member 6 isoform X2
  KO
K04975  transient receptor potential cation channel subfamily V member 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100663115
   04978 Mineral absorption
    100663115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100663115
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100663115
SSDB
Motif
Pfam: Ion_trans
Other DBs
NCBI-GeneID: 100663115
NCBI-ProteinID: XP_003423771
LinkDB
Position
Unknown
AA seq 472 aa
MFQHLMQRRKHIQWTYGPLTSTLYDLTEIDSWGEEQSLLELIVTTKKREARQILDLTPVK
ELVSLKWRRYGRPYFYLLGAIYLLYIICFTMCCVYRPLKPRTSNRTSPRDNGLLQQKLLQ
EAYVTPKDSVRLMGELVTILGALIILLLEIPDIFRVGVTRFFGHTSLGGPFHILIVTYAC
MVLVIVVMRLTNTNGEVIPMSFALVLGWCNVMYFARGFQMIGPFTIMIQKMIFGDLMRFC
WLMAVVILGFASAFYIVFQTEDPHELGHFYNYPMALFSTFELFLTVIDGPANYDVDLPFM
FCITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVVDTTVMLERKLPRCLWP
RSGICGREYGLGDHWYLRVEDRQDLNRQRVQRYAQAFQNLDNDNLDGNSVQKLRLGQTFG
QHLPVPTPSVSRSTSRSSTNWERLRQGALRRELRGVVNKGLEVDQDSWEYQI
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgttccagcacctgatgcagcggcggaagcacatccagtggacctacgggccgctgact
tccaccctgtacgacctcacggagatcgactcctggggagaggagcagtccctgctggag
ctcattgtcaccaccaagaagcgggaggcacgccagatactggacctgacgcctgtgaag
gagctggtgagcctcaagtggaggcggtacgggcggccatacttctacttgctgggcgcc
atctacctgctctacatcatctgtttcaccatgtgctgtgtctaccgccccctcaagccc
aggaccagcaaccgcacgagtccccgagacaatggcctccttcagcaaaagctgctccag
gaggcctatgtgacccccaaggatagcgtccgcctgatgggggagctggtgactatactt
ggagccctgatcatcctgctcctggagatcccggacatcttcagggttggggtcactcgc
ttctttggacatacctccctcggggggccattccatatcctcattgtcacctacgcctgc
atggtgctggtcatcgtggtcatgcggctcaccaataccaacggggaggtgattcccatg
tccttcgccctggtgctgggctggtgcaacgtcatgtattttgcccgaggattccagatg
ataggccccttcaccatcatgatccagaagatgatctttggagacctgatgcgcttctgc
tggctcatggctgtggtcatcctgggctttgcctcagccttctatatcgtcttccagacc
gaggacccccacgagctgggccatttctacaactaccccatggctctattcagtaccttc
gagctcttcctcactgtcatcgatggccctgccaactacgacgtggacctgcccttcatg
ttctgcatcacctatgctgctttcgccatcatcgcgacactgctcatgctcaacctcctc
atcgccatgatgggcgacactcactggcgggtggcccatgagcgggacgagctctggagg
gcccaggtcgtggacactacagtgatgctagagcggaagttgcctcgatgcctgtggcct
cggtctggaatctgtgggcgcgagtatgggctgggggaccactggtaccttcgggtggag
gacaggcaggacctcaaccggcagcgtgtgcagcgctatgcgcaggccttccaaaacctg
gacaacgacaacctggacggcaactcggtgcagaagctgcggcttggccaaaccttcggc
cagcacctgcctgtccccacgccctcggtgtctcggagcacctcccggagcagcaccaac
tgggagaggctgcggcaaggggccttgcggagggagctgcggggtgtggtcaacaagggg
ctggaggtggaccaggacagttgggagtaccagatctaa

DBGET integrated database retrieval system