KEGG   Loxodonta africana (African savanna elephant): 100663606
Entry
100663606         CDS       T04351                                 

Gene name
CACNA1E
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100663606 (CACNA1E)
   04020 Calcium signaling pathway
    100663606 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100663606 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100663606 (CACNA1E)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100663606 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 100663606
NCBI-ProteinID: XP_023404907
LinkDB
Position
Unknown
AA seq 2181 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLYGMGLGLGLDKVEE
ERISRGGSLKGDGGDRSGAVDNQRXPLSLGTREPPWLARPCHGNCDPTQQEAGGGETVVT
FEDRARHRQSQRRSRHRRVRTEGKELSSASRSRSVSQERSLDEDVPTDGEKDREPRGSHG
TKEPAMQEERVQDLRRTNSLMVPRGSGLAGAIDEANAPLVPPHPELEVGKEGALTEQEPE
GSSEQALLGDVQLDVGRAISQSEPDLSCITANTDKATESSSVTVAIADVGPLVDSTVVHI
SNKTDGEASPLKEAEIKEDEEEVEKKKQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHY
VVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQ
GLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKT
IKRLPKLKVIFSEFLPIKSPSPAFFLYYSEKVLFYFYSGFRGNYVDHEKNKMEVKGREWK
RHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVV
FPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQY
RVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKI
IAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQ
GYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSF
FGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFF
CSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLT
LMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQ
QLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQ
LEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDTVAGLSGRSGYPSMSPLSPQEIFQL
AYMEPTDDGQFQEQQSLVLTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRR
SYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQAGWE
SPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSY
SSLLRHSGSLSPPADGSEGGSPLTSKALESNNTCLTESSNSPHAKQSQQCSPQRYISEPY
LALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRHGGPG
PGMMCGAVSDLLSDTEEDDKC
NT seq 6546 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcagtggtcggcaggccagggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaaccccagtgccggcctcggggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcctgtccggcag
aactgtttcaccgtcaacagatccttgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgttcgagtatatgatcctggctaccatcatt
gccaactgcattgtcctggccctggaacagcaccttcccgaggacgacaagaccccgatg
tcccgcagactggagaagacagaaccatatttcattgggatcttttgctttgaagctggg
atcaaaattgtggccctggggttcatcttccataagggctcatacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggctactgcgggaacccatttc
aacacacacgtggatctgaggaccctgcgggctgtgcgtgtcctgaggcccctgaagctc
gtgtcagggattcccagcttgcagattgtattgaagtctatcatgaaggccatggtgcct
cttctgcagattggccttctgctcttctttgccatcctgatgtttgctatcattggcttg
gagttctacagtgggaagttacaccgagcatgcttcatgaacaattcaggtattctagaa
ggatttgatccccctcacccatgtggtgtgcagggctgcccagccggttatgaatgcagg
gactggatcggccccaacgatgggatcactcagtttgataacatcctttttgctgtgctg
actgtattccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtatttcatccccctcatcatcattggatccttc
tttgttctcaacctagtcctgggagtgctttctggggaatttgccaaagagagagagagg
gtggagaaccgaagagctttcatgaagctgcggcgccaacagcagattgagcgggagttg
aatggctaccgtgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaacaaa
aatgctggaacatcggccttagaagtgcttcgaagggcgacaatcaagaggagccggaca
gaggccatgacccgagactccagtgatgaacactgcgttgatatctcttctgtgggcacg
cctcttgcccgagctagtatcaaaagtgcaaaggtggatggtgcttcctatttccggcac
aaggagaggctcctgcgcatctccattcgccacatggtgaaatcccaggtgttctactgg
attgtgctgagcctcgtggctctcaacaccgcctgcgtggccattgtccatcacaaccag
ccccagtggctcacccacctcctctactatgcagaatttttgtttctggggctcttcctc
ttagagatgtccctgaagatgtacgggatggggcctcgtctttattttcactcttcattc
aactgctttgattttggggtcactgtgggcagtatctttgaagtggtctgggcaatcttc
agacctggtacatcttttggaatcagtgtattgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatccctgcgcaatttggtggtctccttgatgagttccatg
aagtctatcatcagtttgctcttcctcctcttcctcttcatcgttgtctttgccctcctg
ggaatgcagctgtttggaggcaggtttaactttaatgatggaactccttcagcaaatttt
gacaccttccctgcagccatcatgactgtatttcagatcctgacaggtgaggactggaat
gaggtgatgtacaacgggatccgttcccagggaggggtcagctcaggcatgtggtcagcc
atctacttcatcgtactcaccttgtttggaaactatacgctgctgaatgtgttcttggcc
atcgctgtggacaatctggccaatgcgcaagagctgaccaaggatgaacaggaggaagag
gaagccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccaatgtctgca
cccaacatgccttctatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagtcacctgtatggcatgggcctgggcctgggtctggataaggtggaggag
gagcgcatcagccgtggggggtccctcaagggggacggaggtgaccggtccggtgccgtg
gacaaccagaggnagcccttgtccctgggcacacgggagcctccgtggctggccaggccc
tgtcatgggaactgtgaccccacccagcaggaggcagggggaggagagactgtggtgacc
ttcgaggaccgggccaggcacaggcagagccagcgacgcagtcggcaccgccgtgtcagg
acagaaggcaaggagctctcctcagcttctcggagcaggtctgtcagccaggagcggagt
ctggatgaagatgtacccaccgatggggagaaagaccgggagcccaggggcagccatggg
accaaggaaccagcaatgcaagaagagagagtccaggatttaaggaggaccaacagccta
atggtacccagaggctccggcctggcaggagccattgatgaggcaaacgcacctctggtc
ccgccccatccagagctggaagtggggaaggagggggcactgacagagcaggagccagag
ggcagcagtgaacaagccctgctgggggatgtgcagctagatgtgggccgggccatcagc
cagagtgagccagacctctcctgcatcacggccaacacggacaaggccacggagagcagc
agtgtcaccgtggccatcgctgacgtgggccccctcgtggattccaccgtggtgcacatt
agtaacaagactgatggagaagccagtcccctgaaggaagcagaaatcaaagaggatgaa
gaggaggtagagaagaagaagcaaaagaaggagaagcgtgagacaggcaaagccatggtg
ccccatagctccatgttcatcttcagcaccaccaacccgatccggagggcctgccactac
gtcgtgaacctgcgctactttgagatgtgcatcctcctggtgattgcagctagcagcatt
gccctggcagctgaggaccctgtcctgaccaactccgagcgcaacaaagtcctgaggtat
tttgactatgttttcactggtgtgttcacctttgagatggtcataaagatgatagaccag
ggtttgatcctgcaggatggatcctacttccgagacctgtggaacatcctggactttgtg
gtggtggttggagcattggttgcctttgctttggcgaatgctttgggaacaaacaaaggg
cgggacatcaagaccatcaagtctctgcgggtgctccgagttctgaggccactgaaaacc
atcaagcgcctgcccaagctcaaggtaatattttcagaatttcttcctatcaaatcccct
tctcctgccttctttctttactatagtgaaaaggtcctattttatttctactctggtttt
agaggcaactatgtagatcatgagaaaaacaagatggaggtgaagggccgggaatggaag
cgccatgaattccactatgacaacatcatctgggccctgctgaccctcttcaccgtctcc
acaggggaaggatggcctcaggttttacagcattccgtagatgtgacagaggaagaccga
ggcccaagtcgcagcaaccgcatggagatgtccatcttttatgtggtctactttgtggtc
ttcccattcttctttgtcaatatctttgtggccctcatcatcatcaccttccaggagcaa
ggggacaagatgatggaggagtgcagcctggaaaagaatgagagggcgtgcatcgacttt
gccatcagtgccaaacctctcacccgctacatgccacagaacaggcacaccttccagtac
cgcgtctggcactttgtagtgtctccatccttcgagtacaccatcatggccatgattgcc
ctgaacactgtcgtgctgatgatgaagtactattctgctccctgtacctatgaactggct
ctcaagtacctgaatattgccttcaccatggtgttttccctggaatgtgtcctaaagatc
atcgcttttggcttcttgaactatttccgagacacctggaatatctttgacttcatcacc
gtgattggcagtatcacagaaattatcctgacagacagcaagctggtcaacaccagtggc
ttcaatatgagcttcctgaagctcttccgagctgcccgcctcataaagcttctgcggcag
ggctacaccatacgtattttactttggaccttcgtgcagtcctttaaggccctcccctac
gtctgtctgttgattgccatgcttttcttcatttatgccatcattgggatgcaggtcttt
ggaaacataaagttagatgaggagagtcacatcaatcggcacaacaacttccgaagtttc
tttgggtccctcatgctgctcttcaggagtgccacaggtgaggcctggcaggagattatg
ctgtcatgccttggggagaaaggctgtgagccggacaccacagcaccatctgggcagaac
gagaacgagcgctgtggcaccgatctggcctacgtttactttgtctccttcatcttcttc
tgttccttcttgatgctcaacttgtttgtggccgtcatcatggacaactttgagtacctg
acacgagattcctccatcctgggacctcaccacttggatgagtttgtccgtgtctgggcg
gagtatgacagagctgcatgtggccgcatccattacactgagatgtatgaaatgctgact
ctcatgtcaccaccgctaggcctcggcaagagatgtccctccaaagtggcatataagaga
ttggtcctgatgaatatgccagtagctgaggacatgacagtccacttcacctccacactt
atggctctgatccggacagccctggacatcaaaattgcaaaaggtggtgcagacaggcag
cagctagattcagagctacaaaaggagaccctggccatctggcctcacctgtcccagaag
atgctggatctgcttgtccccatgcccaaagcctctgacctgactgtgggcaaaatctat
gcagcaatgatgatcatggactactacaaacagagtaaggtgaagaagcagaggcagcag
ctggaggaacagaaaaatgcacccatgttccagcgcatggagccctcatctttgcctcag
gagattatcgctaatgccaaagccctgccttatctccagcaggacactgtcgcaggcctg
agtggccggagtggatacccctcgatgagtccactctccccgcaggaaatattccagttg
gcgtatatggagcccaccgatgatggacagttccaggaacaacagtctctggtgttgaca
gaccctagctccatgagacgttctttttccactattcgggataagcgttcaaattcctcg
tggttggaggagttctccatggagcgaagtagtgaaaacacctacaagtcacgtcgccgg
agctaccactcctccctgcggctgtcagcacatcgcctgaactctgactcaggccacaag
tccgacacccaccgctcagggggcagagagcgggggcgatcgaaagagcgaaagcatctt
ctctctcctgatgtctctcgctgcaactcagaggagcgagggacccaggctggctgggag
tccccagagcgccgtcaatccaggtcacccagtgaaggcaggtcacagacccccaacaga
cagggcacgggctccctgagtgaaagctccatcccctctgtctctgacaccagcacccca
agacgaagtcggcggcagctcccaccagtccctccaaagcctcggcccctcctttcctac
agctccctgctgcgacactctgggagcctctctccacccgctgatgggagtgagggcggc
tccccactcacctccaaggctctggagagcaacaacacttgcctgaccgagtcttccaac
tccccgcacgcgaagcagagccaacagtgctccccccagcgctacatctccgagccctac
ctggccctgcacgaagactcccacgcctcagactgtggcgaggaggagacgcttaccttc
gaagccgctgtggccactagcctgggccgctccaacaccatcggctccgctccgcccctg
cggcacagctggcagatgcccaatgggcactatcggcggcgaaggcatggggggcccggg
ccaggcatgatgtgtggagctgtcagtgacctcctgagtgacacggaagaagacgacaaa
tgctag

DBGET integrated database retrieval system