KEGG   Loxodonta africana (African savanna elephant): 100663645
Entry
100663645         CDS       T04351                                 

Gene name
ARMC5
Definition
(RefSeq) LOW QUALITY PROTEIN: armadillo repeat-containing protein 5
  KO
K22499  armadillo repeat-containing protein 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100663645 (ARMC5)
SSDB
Motif
Pfam: Arm HEAT_2 BTB HEAT_EZ Neurochondrin V-ATPase_H_N
Other DBs
NCBI-GeneID: 100663645
NCBI-ProteinID: XP_023414759
LinkDB
Position
Unknown
AA seq 944 aa
MAAARPAPTDSLSFCLAQLTAAAGEGLGGGKDTATNETPLGRALLALRTRHVKAAGGIER
FRARGGLRPLLALLRRAATADPAPPQASPGSAPSAISAGPASPSGSAPSASSSTSSLPAR
LRKTLDLGLSILANCCTEGACRTEVRRLGGILPLVTILQCVKTDSIQNRTARALGNLAME
PESCRDIHSAGAVPLLLESLTACQDSQCLQSVVRALRNLADSPQHRLALAQQGAVRPLAE
LLAAAPDPALTSALVRALLELSRGCSRACAEQLSLGGGLGPLVSLASHPKRAVREATILT
LANLCAQGLVRPALGNAGGVEVLLGELRRRRGPNGANPASQQPLVRAVCLLCXEAINRAR
LRDAGGLELLMGLLRDSRARAWHPRVVAALVGFLYDTGALGGLQALGLXPFLAGQLCGGG
GEKKKRGEEKPASWDFPEERTPRGGQSSGPISSFPYFLTLCRSWLISEGYAAGPGDISPD
WSPERCPPLEPSEPSSPTPGPTQLQTPRVVCTPRRSSATSTEEPWGREGPALLLLSRFSQ
VPDPSGALVTGPALCGLLAYVTGAPGPPNPRALRILARLTCNPACLEAFVRSYGAALLRA
WLVLGVAPDDWPAPCARPALRSQHRELGEMLLQNLTVQAESPFGVGALTHLLLSGSPEDR
VACALTLPFICRKPSLWRRLLLDQGGLRLLLAALTRPAPHPLFLFFAADSLSCLQGLLSP
TVSPVLPPAIPVDLDLPSPCLYESLLGPAPVPAPDLHFLLDSGLRLPAQRATSATASPFF
RALLAGSFVEAQMDLVPLRGLSPSAAWPVLHHLHGCRGCGAALGPVPSLGQPLLGSEAEE
ALEAAGRFLLPGLEEELEEAVGRIHLGPQGGPESVGEVFRLGRPRLAAHCARWTLGPGQC
PRKRALALVGLVEAAGEEAGPLTEALLAVVMGAEAGGKSPGVDY
NT seq 2835 nt   +upstreamnt  +downstreamnt
atggcggctgcaaggccagcccccacggactcgctctcgttctgcctcgcgcagctcacg
gcggcggccggggagggtctgggtgggggaaaggacacggctaccaacgagacaccctta
ggccgtgcgcttttagccctccgcacgcgccacgtcaaggcagcagggggaatcgaacgc
ttccgggcacgcggcgggctccgcccccttcttgcgctgctacggcgagcggctacggcg
gaccccgccccgccccaggcaagccctggctccgccccttcggcgatttctgctggtccc
gcctccccgtcgggctccgccccttctgcgtcctcatcgacgtcttcactgccagcgcgc
ctgcgcaagacgctggacttgggcctcagcatcctagccaactgctgtacggaaggggcg
tgccggacggaagtgcgcagactcggaggcattctccctttggtgaccattcttcagtgt
gtgaagacagacagcatccagaaccgaacagcccgtgctctggggaacttagccatggaa
cctgagagctgtagggacatccactctgctggtgctgttcccctgctccttgagagcctg
acggcctgccaggactctcagtgcttgcagagcgtggtgcgtgccctccgcaaccttgca
gactccccccagcaccgcttggccctggcacagcagggagcagtgcgtccactggctgag
ctcttggccgctgccccagaccctgcactgacttcagccctagtccgtgccctcctggag
ctgagccgaggctgttcccgggcctgtgctgagcagctaagtctgggcggcgggctgggc
ccacttgtcagcctggcctctcaccccaaacgagccgtgcgtgaggcaaccatcctgacc
cttgccaacctgtgtgcccagggcctggtccggcctgcactgggcaatgctggtggcgtg
gaggtgctgctaggagagctccggcggcgccggggccctaatggggccaatccggcctcc
cagcagcccctggtgcgggctgtctgcctgctgtgcnaggaggccatcaaccgggcccgg
ctgcgcgacgctggtggtctggagctgctgatgggcctgcttcgtgactctcgtgccaga
gcctggcaccctcgtgttgttgctgccctcgtgggcttcctctatgatactggggccctg
ggcgggctgcaggctctgggcttgnntcccttcctggctgggcagctgtgtggggggggt
ggtgaaaaaaaaaaaagaggggaagaaaaacctgcttcctgggacttccctgaggagcgg
accccccgagggggacagagctctggacccatctcctcttttccctattttctcaccctc
tgcaggtcatggctcatttcagagggctatgctgctggccctggagacatctctcccgac
tggtcccctgagcgctgcccgccactggagccctctgagccatccagccctaccccaggc
ccgacccaactgcagacaccacgtgtagtgtgcacccccagacgcagctctgccaccagc
acagaggagccttggggtcgtgaggggccagcgcttctgctgctgtcacgcttctcccag
gtgcccgacccaagtggggcgcttgtgacaggcccagcgctgtgcggcctgctagcctac
gtgacaggtgcacctggcccaccaaacccgcgcgccctgcgcatcctggcgcgcctcacc
tgcaaccctgcttgcctggaggcctttgtgcgtagctatggtgcagcgctactgcgagcc
tggcttgtgctcggtgtcgctcctgatgactggcctgcaccgtgtgcccggcctgccctc
cgcagtcagcaccgggaactaggcgagatgctgctgcagaacctgaccgtacaggccgaa
tctccctttggagtgggtgccctcacccatctgctgctctctgggagccctgaggaccgt
gtggcctgcgcactgaccctccccttcatctgccggaaaccctctctgtggcgtcggcta
cttctggaccagggcggcctccgtctcctcctcgcagcactgactcggccggccccacac
ccactcttcctcttctttgccgcggactctctttcctgcctccaaggcctgttgtctccc
actgtgagcccagtcctcccacctgcaatccctgtggacctagacctgccctccccttgc
ctctatgaatctctgctgggtccggcccctgtcccagcccctgacttgcacttcctactg
gactcaggcctacgactccctgcccagcgggccacctcagctaccgcctccccattcttc
cgggccctgcttgctggcagctttgttgaagctcagatggacctggtgccacttcgaggc
ctgtcacccagtgcagcctggcctgtcctgcatcatttgcatggctgccggggctgcggg
gctgctctagggcctgtgccctcactgggccagcccttgctcggctcagaggctgaggag
gccctggaggctgctggtcgtttcctgctgcccgggctggaggaggagctggaagaggct
gtgggccgtattcacctggggccccagggtggcccagagtcggtgggtgaggtgttccgc
ctgggacggccccggctggctgcccactgtgctcgctggacactggggccgggccagtgc
ccacggaagcgggctctggccctggtggggcttgtggaggcagcgggtgaggaggcaggg
cctctgactgaggctttactggctgtggtgatgggggctgaggcagggggcaagagtccc
ggtgtagactattga

DBGET integrated database retrieval system