KEGG   Loxodonta africana (African savanna elephant): 100663829
Entry
100663829         CDS       T04351                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04062  Chemokine signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04621  NOD-like receptor signaling pathway
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04742  Taste transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05146  Amoebiasis
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
Module
lav_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100663829 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100663829 (PLCB3)
   04310 Wnt signaling pathway
    100663829 (PLCB3)
   04371 Apelin signaling pathway
    100663829 (PLCB3)
   04020 Calcium signaling pathway
    100663829 (PLCB3)
   04070 Phosphatidylinositol signaling system
    100663829 (PLCB3)
   04072 Phospholipase D signaling pathway
    100663829 (PLCB3)
   04071 Sphingolipid signaling pathway
    100663829 (PLCB3)
   04022 cGMP-PKG signaling pathway
    100663829 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100663829 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100663829 (PLCB3)
   04613 Neutrophil extracellular trap formation
    100663829 (PLCB3)
   04621 NOD-like receptor signaling pathway
    100663829 (PLCB3)
   04062 Chemokine signaling pathway
    100663829 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    100663829 (PLCB3)
   04922 Glucagon signaling pathway
    100663829 (PLCB3)
   04929 GnRH secretion
    100663829 (PLCB3)
   04912 GnRH signaling pathway
    100663829 (PLCB3)
   04915 Estrogen signaling pathway
    100663829 (PLCB3)
   04921 Oxytocin signaling pathway
    100663829 (PLCB3)
   04926 Relaxin signaling pathway
    100663829 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    100663829 (PLCB3)
   04918 Thyroid hormone synthesis
    100663829 (PLCB3)
   04919 Thyroid hormone signaling pathway
    100663829 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100663829 (PLCB3)
   04916 Melanogenesis
    100663829 (PLCB3)
   04924 Renin secretion
    100663829 (PLCB3)
   04925 Aldosterone synthesis and secretion
    100663829 (PLCB3)
   04927 Cortisol synthesis and secretion
    100663829 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100663829 (PLCB3)
   04270 Vascular smooth muscle contraction
    100663829 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    100663829 (PLCB3)
   04971 Gastric acid secretion
    100663829 (PLCB3)
   04972 Pancreatic secretion
    100663829 (PLCB3)
   04973 Carbohydrate digestion and absorption
    100663829 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100663829 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100663829 (PLCB3)
   04725 Cholinergic synapse
    100663829 (PLCB3)
   04728 Dopaminergic synapse
    100663829 (PLCB3)
   04726 Serotonergic synapse
    100663829 (PLCB3)
   04720 Long-term potentiation
    100663829 (PLCB3)
   04730 Long-term depression
    100663829 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    100663829 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    100663829 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    100663829 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100663829 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663829 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100663829 (PLCB3)
   05016 Huntington disease
    100663829 (PLCB3)
   05017 Spinocerebellar ataxia
    100663829 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    100663829 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100663829 (PLCB3)
   04934 Cushing syndrome
    100663829 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100663829 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100663829 (PLCB3)
   05142 Chagas disease
    100663829 (PLCB3)
   05143 African trypanosomiasis
    100663829 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100663829 (PLCB3)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100663829 (PLCB3)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100663829 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100663829 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y PLC-beta_C PH_14 EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 100663829
NCBI-ProteinID: XP_023415409
LinkDB
Position
Unknown
AA seq 1190 aa
MEVDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLLTVVAGPDPVNTTFL
NFMAVQDDTAKIWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKM
FSADKKRVETALESCGLNFNRSESIRPDEFSLDIFERFLNKLCLRPDIDKILLEIGAKGK
PYLTLEQLMEFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSR
YLGGEENGILPLESLDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGC
RCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDS
AKQQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGVP
DSSVRKRPLEQSNSALSESSATTEPSSPQLGSPSSDSCPGLSNGEEAGLEKPGLGPRKSL
GEEGLRQGPDALGPADREDEEEDEEEEEQTDPKKLTSDEGTASSEVNATEEMSTLVNYIE
PVKFKSFEAARKRNKCFEMSSFVETKGLEQLKESPMEFVEYNKKQLSRIYPKGTRVDSSN
YMPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEV
IVDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPTDTRRKYRTRTSQGNSFNPVWDE
EPFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPAL
LVYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGENEAQTGPEMSQEPQSQ
QLGSQLPLNATLSQLETSACRSPASCAPPTSSSLTSPGQRDDLIASILSEVAPTPLDELR
GHKALVKLRSRQERDLRELLKKHQRKALTLSRRLLNNLAQVRAEGRSRRRGGTAEEEEEE
EEEVKRYQEFQRRQVQSLLELREAQVDTEADRRLEHLRQVQHRLREVVLEAHTTQLKKLK
ELNEREKKDLQKILDRKRHNSISEAKTREKYKKEVELTEINRRHITESVNSIRRLEEAQK
QRHDCLVAGQQQVLQQLAEEEPKVRPWGRRAGEKTEAQSRSRVSQTTAKPRHPDLEVQGG
PGPSIADSPRPAWKMNSMEWQRQRGCRQALQQGQAGPSSRPLLAFWRIWG
NT seq 3573 nt   +upstreamnt  +downstreamnt
atggaggtggacacattggacatcagttccatcagggacacccggacaggtcgctatgcc
cgcctgcccaaggaccccaagatccgggaggttctgggctttgggggtcctgatgcccgg
ctggaagagaagctgctaacggtggtggctgggccagatccggtgaacacaacgttcttg
aacttcatggccgtgcaggatgacacagccaagatctggtccgaggagctgttcaagctg
gcgatgaacatcctggctcagaacgcttcccgcaacaccttcctgcgcaaagcatacacg
aagctgaagctgcaggtgaaccaggatgggcggatcccagtcaagaacatcctgaagatg
ttctcagcagacaagaagcgggtagagactgcgttggaatcctgcggcctcaatttcaac
cggagcgagtccatccggcctgatgagttttccttggacatctttgagcggtttctgaac
aagctgtgtctgcggccggatattgacaagatcctgctggagataggagccaaggggaag
ccatacctgacgctggagcagctcatggagttcatcaaccagaagcagcgcgatccgaga
ctcaacgaagtgctgtacccgccactgcggccctcacaggcccggctgctcattgagaag
tacgagcccaaccagcagttcctggagcgagaccagatgtccatggagggtttcagccgc
tacctgggaggcgaggagaatggcatcctgcccctggagtccctggacctgagtgcggac
atgacccagccactgagcgcctactttatcaactcctcacacaacacttatctcaccgcg
gggcagctggctgggacctcatcggtggagatgtaccggcaggcgctgctgtggggctgc
cgctgtgtggagctggatgtgtggaaggggcggccgcccgaggaggagcccttcatcacc
cacggcttcaccatgaccacggaggtgccgctgcgtgacgtacttgaggccattgctgag
accgccttcaagacctcgccctaccccgttatcctctcctttgagaaccacgtggactcg
gcgaagcagcaggccaagatggctgagtactgccggtctatctttggggatgcgctgctc
attgacccgctggacaagtacccgctggccccgggcgttcccctgcctagcccccaggac
ctgatgggccgcatcctggtgaagaacaagaagaggcaccagcccagcactggcgtccca
gacagctctgtgcgcaagcggccgctggagcagagcaattcagccctgagcgagagctcc
gccaccactgagccctcctcgccccagcttgggtcccccagctccgacagctgtccaggc
ctgagcaatggggaggaggcggggcttgagaagcccggcctggggcctcggaagtctctg
ggcgaggaggggctgcgccagggtcctgatgctcttgggcctgctgaccgtgaggacgag
gaagaagacgaggaagaggaggagcagacagaccccaaaaagctgacctcagatgagggc
acagccagcagtgaggttaatgccactgaggaaatgtcgacgttggtcaactacattgag
cctgtcaagttcaagtcctttgaggctgctcgaaagaggaacaagtgctttgagatgtca
tcctttgtggagaccaaaggcctggagcaactgaaagagagccccatggagttcgtggaa
tacaacaagaagcagctcagccgaatctaccccaagggtacccgcgtggactcgtccaac
tacatgccccagctcttctggaacgtgggctgccagctcgtcgcgctcaacttccagacc
ctggatgtggcgatgcagctgaatgcaggtgtgtttgagtacaacgggcgcagcggctac
ctgctcaagccggagttcatgcggcggccagacaagtccttcgaccccttcactgaagtc
attgtggatggcatcgtggccaacgccttacgggtcaaggtgatctcggggcagttcctg
tctgacaggaaggtgggaatctatgtggaggtggacatgttcggcctccccactgacacg
cggcgcaagtaccgcacacggacctcacaggggaactcgttcaaccccgtgtgggatgag
gagcccttcgacttccccaaggtggtgcttccgacgctggcttcactccgcattgcagcc
tttgaggagggcggcaagttcgtggggcaccggatcctgcctgtctctgccatccgctca
gggtaccactacgtctgcctgcggaatgaggccaaccagccactgtgtctgccggccctg
cttgtctacaccgaggcctccgactacatccccgatgaccatcaggactacgcagaggcc
ctgatcaaccccattaagcatgtcagcctgatggaccagagggcaaagcagctggctgcc
cttattggggagaatgaggcccagactggccctgagatgagccaggagccccagtctcag
cagctgggctcccagctgcctctcaatgccacactcagccaactggaaacatctgcctgc
cgaagccccgcctcttgtgccccccctaccagttcctccctcaccagcccaggccagagg
gatgacctcattgccagcatcctctcagaggtggccccgaccccgctggatgagctccga
ggccacaaggcgctggtgaagcttcggagccggcaggagcgagacctgcgggagctgctc
aagaagcaccagcggaaggcactcactctctcgcgccgcttgctgaacaacctggcgcag
gtccgggcggagggcaggagccggcgccgaggggggactgctgaagaggaggaggaggag
gaggaggaggtgaagcggtaccaggagttccagaggaggcaggtacagagtctgctggag
ctgagggaggcccaggtggacacggaggctgatcggaggctggagcacctgagacaggtt
cagcatcggctcagggaggttgtcctggaggcacacacgactcagctcaagaagctgaag
gagcttaatgagagagagaagaaggacctgcagaagatcctggacaggaagcgccacaac
agtatctcggaggccaaaacaagggagaaatataagaaagaagtggaactgacggagatt
aatcgtcggcacatcaccgagtctgtcaactccatccgccggctggaggaggcccagaag
cagcggcacgactgcctggtagctgggcaacagcaggtcctacagcagctggcggaagag
gagcccaaggtgaggccatggggcaggcgggcaggtgagaaaactgaggcccagagcaga
agtcgtgtgtcccagaccacagctaaaccaagacatcctgacctggaggttcagggtggg
cctggcccctccatagcggacagtccaaggccagcctggaagatgaacagcatggaatgg
cagagacagcgagggtgccgccaggctctgcagcagggtcaggctggcccttcttcaagg
cctctcctagctttctggcgcatctggggctga

KEGG   Loxodonta africana (African savanna elephant): 100668575
Entry
100668575         CDS       T04351                                 

Gene name
PLCB2
Definition
(RefSeq) LOW QUALITY PROTEIN: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04062  Chemokine signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04621  NOD-like receptor signaling pathway
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04742  Taste transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05146  Amoebiasis
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
Module
lav_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100668575 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100668575 (PLCB2)
   04310 Wnt signaling pathway
    100668575 (PLCB2)
   04371 Apelin signaling pathway
    100668575 (PLCB2)
   04020 Calcium signaling pathway
    100668575 (PLCB2)
   04070 Phosphatidylinositol signaling system
    100668575 (PLCB2)
   04072 Phospholipase D signaling pathway
    100668575 (PLCB2)
   04071 Sphingolipid signaling pathway
    100668575 (PLCB2)
   04022 cGMP-PKG signaling pathway
    100668575 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100668575 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100668575 (PLCB2)
   04613 Neutrophil extracellular trap formation
    100668575 (PLCB2)
   04621 NOD-like receptor signaling pathway
    100668575 (PLCB2)
   04062 Chemokine signaling pathway
    100668575 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    100668575 (PLCB2)
   04922 Glucagon signaling pathway
    100668575 (PLCB2)
   04929 GnRH secretion
    100668575 (PLCB2)
   04912 GnRH signaling pathway
    100668575 (PLCB2)
   04915 Estrogen signaling pathway
    100668575 (PLCB2)
   04921 Oxytocin signaling pathway
    100668575 (PLCB2)
   04926 Relaxin signaling pathway
    100668575 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    100668575 (PLCB2)
   04918 Thyroid hormone synthesis
    100668575 (PLCB2)
   04919 Thyroid hormone signaling pathway
    100668575 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    100668575 (PLCB2)
   04916 Melanogenesis
    100668575 (PLCB2)
   04924 Renin secretion
    100668575 (PLCB2)
   04925 Aldosterone synthesis and secretion
    100668575 (PLCB2)
   04927 Cortisol synthesis and secretion
    100668575 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100668575 (PLCB2)
   04270 Vascular smooth muscle contraction
    100668575 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    100668575 (PLCB2)
   04971 Gastric acid secretion
    100668575 (PLCB2)
   04972 Pancreatic secretion
    100668575 (PLCB2)
   04973 Carbohydrate digestion and absorption
    100668575 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100668575 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100668575 (PLCB2)
   04725 Cholinergic synapse
    100668575 (PLCB2)
   04728 Dopaminergic synapse
    100668575 (PLCB2)
   04726 Serotonergic synapse
    100668575 (PLCB2)
   04720 Long-term potentiation
    100668575 (PLCB2)
   04730 Long-term depression
    100668575 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    100668575 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    100668575 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    100668575 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100668575 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668575 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100668575 (PLCB2)
   05016 Huntington disease
    100668575 (PLCB2)
   05017 Spinocerebellar ataxia
    100668575 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    100668575 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100668575 (PLCB2)
   04934 Cushing syndrome
    100668575 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100668575 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100668575 (PLCB2)
   05142 Chagas disease
    100668575 (PLCB2)
   05143 African trypanosomiasis
    100668575 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100668575 (PLCB2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100668575 (PLCB2)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100668575 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100668575 (PLCB2)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y C2 EF-hand_like
Other DBs
NCBI-GeneID: 100668575
NCBI-ProteinID: XP_023414417
LinkDB
Position
Unknown
AA seq 898 aa
MSLLNPVLLPPEVKTYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKDWAEDVLALVKHPLTTNAPRSAFLDKILVKLQMQLNSEGKIPVKNFFQLFPADRKR
VEAALSACHLAKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDPRLNSLLFPPAQPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLSGPEN
SVLAQDKLLLYQDMTQPLNHYFINSSHNTYLTGSQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGDMLLTEPLEKFPLKPGTPLPSPEDLRGKILIKNKKNQFSGPISLSKEPGEA
EGSCPPKVLVGEDTVWTGEEGAELEEEEVGEEEEEESGSLDEEEIKKMQSDEGTAGLEVT
AYEEMSSLVNYIQPTKFISFEFSSQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMS
RIYPKGTRVDSSNYMPQMFWNSGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFM
RRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTK
LSPSPNSINPVWKEEPFVFEKIMIPELASLRVAVMEENNKFLGHRIIPINALNSGYHHLC
LHSESNMPLTMPALFVFLEMKDYVPDTWADLTVTLTNPIKFFSAHDKKSVKLKEAMGGGL
PENPFPPRSSVAGQVNGTSAPTSNGSAGVYFRSSHPLGGLRRRPRLHPQAHSSLAAAL
NT seq 2697 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccgaggtgaagacctatctgagccaaggc
gagcgcttcatcaaatgggatgatgaaactacaatagcctccccggttatcctccgagtg
gatcccaagggttattacttatactggacatatcagagtaaggaaatggagtttctggat
atcaccagcatccgggatacccgctttgggaagtttgccaagatacccaagagccagaag
ctccgggatgtcttcaacatggactttcctgacaacagcttcctgctgaagacactcact
gtggtgtctggccctgacatggtggacctcaccttccacaacttcgtctcctacaaggag
aatgtgggcaaggactgggctgaggatgtcctggccctggtcaagcacccgctgacgacc
aacgcgccccgcagcgccttcctggacaagatcctggtgaagctccagatgcagctcaac
tctgaagggaagattcctgtgaagaattttttccagctgtttcctgctgatcggaagcgg
gtggaagcggccctcagtgcctgccatctcgccaaaggcaagaatgacgccattaatcct
gaagacttcccagaatctgtctataagagtttcctcatgagcctctgccctcggccagaa
atagatgagatcttcacttcctaccatgccaaggccaaaccgtacatgaccaaggaacac
ctgaccaaattcatcaaccagaaacagcgggacccacggctcaactccctgctgttccca
ccagcacagcctgaccaggtgcagggcctcattgacaagtatgagcccagtggcatcaat
gtgcagaggggtcagctgtcacctgagggcatggtctggtttctctctgggccagagaac
agcgtgctggcccaggacaagctgctgctttaccaagacatgacacagccactcaatcat
tacttcatcaactcctcacacaacacatacctgacaggcagccagttctcaggcctttcc
tcggctgagatgtaccgccaggtgctgctgtctggctgccgctgtgtggagctagactgc
tggaaggggaagcccccagatgaggaacccattatcacccatggcttcaccatgaccaca
gacatattcttcaaggaagctattgaagctattgcagaaagtgcctttaagacctcccct
tatcctgtcatcctgtcatttgaaaaccatgtggactcaccccgccagcaggctaagatg
gctgagtactgccggacgatgtttggggatatgctgctcaccgagcccctggaaaagttc
ccgctaaaaccaggtacccccctgcccagccccgaggacctccggggcaaaatcctcatc
aagaacaagaagaaccagttttctggcccaatatccctcagcaaggagcctggggaggct
gagggcagctgcccacccaaagtcctggtgggtgaggacacagtgtggactggtgaggaa
ggggctgagctggaagaggaagaggtgggagaggaagaggaggaggagtccggaagcctg
gatgaagaagagataaagaagatgcagtcggatgagggcacagcaggcctggaggtgaca
gcttacgaggagatgtccagcctcgtcaattacatccagcccaccaagttcatctccttt
gagttctcttcccagaagaaccgcagttatgtcatttcctccttcaccgagctcaaggcg
tatgacctgctctccaaggcctcagtgcagtttgtggactacaacaagcgccagatgagc
cgaatttaccccaagggcacccgcgtggactcctccaactacatgccccagatgttctgg
aattccggttgccagatggtcgccctcaacttccagacgatggacctgcccatgcagcag
aatatggccttgtttgagttcaacgggcagagcggctacctcctcaaacatgagttcatg
cgccggccggacaagcagttcaaccccttctcggtggaccgcatcgacgtggtggtcgcc
accaccctgtcgattacggtgatctctgggcagttcctgtctgaacgcagtgtgcgcacc
tacgtggaagtggagctgttcggccttcctggggatcccaagaggcgctatcgtaccaag
ctgtcacccagtcctaactccatcaatcctgtctggaaagaggagccttttgtctttgaa
aagatcatgatacctgagctggcctccctcagggtggccgtgatggaggaaaacaacaag
tttcttggacaccgcatcatccccatcaatgcactcaactctggataccatcacctgtgc
ctgcacagtgagagtaatatgccccttaccatgcccgcgctcttcgtcttcctggagatg
aaggactatgtccctgacacctgggcagatcttaccgtgaccctcaccaaccccatcaag
ttcttcagtgctcatgataagaagtctgtgaagctcaaggaggccatgggaggaggtctg
cctgagaatcccttcccacccaggagttcagttgctggccaggtcaatgggacatcagct
ccaacaagcaacgggtcagcaggtgtgtacttcaggtcctcccacccactgggaggcctc
cgtcgtcgtcctcgtcttcacccacaggcacattccagcctggcagcggctctttaa

KEGG   Loxodonta africana (African savanna elephant): 100670617
Entry
100670617         CDS       T04351                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04062  Chemokine signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04621  NOD-like receptor signaling pathway
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04742  Taste transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05146  Amoebiasis
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
Module
lav_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100670617 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100670617 (PLCB4)
   04310 Wnt signaling pathway
    100670617 (PLCB4)
   04371 Apelin signaling pathway
    100670617 (PLCB4)
   04020 Calcium signaling pathway
    100670617 (PLCB4)
   04070 Phosphatidylinositol signaling system
    100670617 (PLCB4)
   04072 Phospholipase D signaling pathway
    100670617 (PLCB4)
   04071 Sphingolipid signaling pathway
    100670617 (PLCB4)
   04022 cGMP-PKG signaling pathway
    100670617 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100670617 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100670617 (PLCB4)
   04613 Neutrophil extracellular trap formation
    100670617 (PLCB4)
   04621 NOD-like receptor signaling pathway
    100670617 (PLCB4)
   04062 Chemokine signaling pathway
    100670617 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    100670617 (PLCB4)
   04922 Glucagon signaling pathway
    100670617 (PLCB4)
   04929 GnRH secretion
    100670617 (PLCB4)
   04912 GnRH signaling pathway
    100670617 (PLCB4)
   04915 Estrogen signaling pathway
    100670617 (PLCB4)
   04921 Oxytocin signaling pathway
    100670617 (PLCB4)
   04926 Relaxin signaling pathway
    100670617 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    100670617 (PLCB4)
   04918 Thyroid hormone synthesis
    100670617 (PLCB4)
   04919 Thyroid hormone signaling pathway
    100670617 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    100670617 (PLCB4)
   04916 Melanogenesis
    100670617 (PLCB4)
   04924 Renin secretion
    100670617 (PLCB4)
   04925 Aldosterone synthesis and secretion
    100670617 (PLCB4)
   04927 Cortisol synthesis and secretion
    100670617 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100670617 (PLCB4)
   04270 Vascular smooth muscle contraction
    100670617 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    100670617 (PLCB4)
   04971 Gastric acid secretion
    100670617 (PLCB4)
   04972 Pancreatic secretion
    100670617 (PLCB4)
   04973 Carbohydrate digestion and absorption
    100670617 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100670617 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100670617 (PLCB4)
   04725 Cholinergic synapse
    100670617 (PLCB4)
   04728 Dopaminergic synapse
    100670617 (PLCB4)
   04726 Serotonergic synapse
    100670617 (PLCB4)
   04720 Long-term potentiation
    100670617 (PLCB4)
   04730 Long-term depression
    100670617 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    100670617 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    100670617 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    100670617 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100670617 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670617 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100670617 (PLCB4)
   05016 Huntington disease
    100670617 (PLCB4)
   05017 Spinocerebellar ataxia
    100670617 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    100670617 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100670617 (PLCB4)
   04934 Cushing syndrome
    100670617 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100670617 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100670617 (PLCB4)
   05142 Chagas disease
    100670617 (PLCB4)
   05143 African trypanosomiasis
    100670617 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100670617 (PLCB4)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100670617 (PLCB4)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100670617 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100670617 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7
Other DBs
NCBI-GeneID: 100670617
NCBI-ProteinID: XP_003411575
UniProt: G3SXY0
LinkDB
Position
Unknown
AA seq 1175 aa
MAKPYEFNWQKEVPSFLQDGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRLGAVPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTSGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFRKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKNKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRILPSPNDLRRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVNILEDDNEEEIECADPEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNSK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LGSGMEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLISAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3528 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccttcctttctgcaagacgga
gcagtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgaatttggcttctttctgacctggaaaagcgaaggcaaggaagggcaagtgcta
gaatgctccctcatcaacagtattcggctgggagccgtacccaaggaccccaaaatcttg
gcggctctcgaagctgttggaaaatcagaaaatgacctggaagggcggatagtgtgtgtc
tgcagcggtacagatctggtgaacatcagtttcacttacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgcgatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
agtggtaaaattccagttaggagtattactagaacctttgcgtcgggaaaaacagaaaag
gtgatctttcaagccctcaaggagttaggtcttcccagtggaaagaatgatgaaatcgag
cctgcagcgtttacttacgaaaagttttatgaactgacacaaaagatttgtcctcggaca
gatatagaggatctttttagaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcagcgagatcctcgactgaatgaaattttattc
ccattttatgatgctaaaagagccatgcagatcattgagatgtatgagcctgacgaagat
ttgaagaataaaggcctcatatcaagtgatgggttttgcagatatctgatgtcagatgaa
aatgccccagtcttcctagatcgcttagaactttatcaagaaatggaccaccctttggct
cactacttcatcagttcttcccataacacctatctcactggccgacagtttggtggaaag
tcttcggtagaaatgtacagacaggttctcctggctggctgcagatgtgttgaacttgac
tgttgggatggaaaaggtgaagaccaagaaccaattataactcacggaaaagcaatgtgt
acagatatcctttttaaggatgtaattcaagccatcaaggaaactgcgtttgtcacatcc
gagtatcctgtaattctgtcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccactcgaacctggcaggatcttgccatcccccaatgacctcagaagaaaaatactcatc
aaaaataaacggctgaaacctgaagttgagaaaaaacagctcgaagctttgaaaagtatg
atggaagctggagaatctgctgccccagttaacatcttagaggatgataatgaagaggaa
atagaatgcgctgacccagaggaggaagctcatcctgaattcaaatttggcaatgaactt
tctgctgatgacttgggtcacaaggaagctgttgcaaatagtgtcaagaagggcctggtt
actgtagaagatgagcaggcgtggatggcatcttataaatatgtaggtgctaccactaac
atccacccgtatttatccacaatgatcaactacgcacagcctgtgaagttccaaggtttc
catgtggctgaagaacgcaatatccattacaacatgtcttcttttaatgaatcagtcggt
ctaggctacttgaagacacacgcaattgaatttgtgaattataacaaacggcaaatgagt
cgcatttaccccaagggaggtcgagtggattccagtaattacatgcctcagattttctgg
aacgctggctgccagatggtttcactgaactatcaaaccccagatttagcgatgcaattg
aatcaagggaaatttgagtataatggatcgtgcgggtaccttctcaaaccagatttcatg
aggcggcccgatcgaacatttgatcccttctctgaaactcctgttgatggggttattgca
gccacttgctcagtgcaggtcatatcaggtcaattcttatccgataagaaaattggcacg
tatgtagaagtggatatgtacgggttgcccacagacactatacgtaaggaattccgcact
cgtatggtgatgaacaatggtctcaatccagtttacaatgaagaatcattcgtctttcgg
aaggtgatccttccagacctggctgtcttgagaatagcagtgtacgatgacaacagtaag
ctgattggccagaggatcctcccactggatggtctccaagcaggctataggcacatttcc
cttcgaaatgaaggaaacaaaccattgtcactgccaaccattttttgcaatattgtgctt
aaaacatacgtgcctgatggatttggagatattgtggatgcattgtcggatccgaagaaa
tttctttcaattacggaaaagagagcagaccaaatgagagctatgggcattgaaaccagt
gacatagccgatgtgcccagtgacacttccaagaatgacaagaaaggaaaggccaacact
gccaaagcaaacgtgacccctcagagtagctctgagctcagaccaaccaccacagcggcc
ctagggtctggcatggaagccaagaaaggtattgaacttatccctcaagtgagaatagaa
gatttaaagcagatgaaggcttacttgaagcatctaaagaaacaacagaaggagctaaac
tctttgaagaagaaacatgcaaaggagcacagcaccatgcagaagttacactgcacacaa
gttgacaaaattgtggcacagtatgacaaagagaagtcaactcatgagaaaatcctagag
aaggcaatgaagaagaagggaggaagtaattgtcttgaaatgaaaaaagaaacagaaatt
aaaattcagacgctgacatcagatcacaaatctaaggtcaaagagattgtggcacagcac
accaaagagtggtcagaaatgatcaacacccacagtgctgaggagcaagaaatccgtgac
ctgcatctcagccagcagtgcgagctgttgaaaaagctgctgatcagtgctcatgagcag
caaactcagcagctgaaactgtcccatgacagggaaagcaaggaaatgcgagctcaccag
gctaagatttctatggaaaacagcaaagccatcagccaagataaatctatcaagaataaa
gcagaacgagaaaggagggtcagagagttaaacagcagcaacaccaaaaagtttctggaa
gaaagaaagagacttgcaatgaagcagtccaaagaaatggatcagttgaaaaaagtccag
cttgaacacttagaattcctagagaaacagaatgagcaggcgaaggagatgcagcagatg
gtgaaattggaagccgagatggatcgcagaccagcaacagtagtgtga

KEGG   Loxodonta africana (African savanna elephant): 100672435
Entry
100672435         CDS       T04351                                 

Gene name
PLCB1
Definition
(RefSeq) LOW QUALITY PROTEIN: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04062  Chemokine signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04621  NOD-like receptor signaling pathway
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04742  Taste transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05146  Amoebiasis
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
Module
lav_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100672435 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100672435 (PLCB1)
   04310 Wnt signaling pathway
    100672435 (PLCB1)
   04371 Apelin signaling pathway
    100672435 (PLCB1)
   04020 Calcium signaling pathway
    100672435 (PLCB1)
   04070 Phosphatidylinositol signaling system
    100672435 (PLCB1)
   04072 Phospholipase D signaling pathway
    100672435 (PLCB1)
   04071 Sphingolipid signaling pathway
    100672435 (PLCB1)
   04022 cGMP-PKG signaling pathway
    100672435 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100672435 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100672435 (PLCB1)
   04613 Neutrophil extracellular trap formation
    100672435 (PLCB1)
   04621 NOD-like receptor signaling pathway
    100672435 (PLCB1)
   04062 Chemokine signaling pathway
    100672435 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    100672435 (PLCB1)
   04922 Glucagon signaling pathway
    100672435 (PLCB1)
   04929 GnRH secretion
    100672435 (PLCB1)
   04912 GnRH signaling pathway
    100672435 (PLCB1)
   04915 Estrogen signaling pathway
    100672435 (PLCB1)
   04921 Oxytocin signaling pathway
    100672435 (PLCB1)
   04926 Relaxin signaling pathway
    100672435 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    100672435 (PLCB1)
   04918 Thyroid hormone synthesis
    100672435 (PLCB1)
   04919 Thyroid hormone signaling pathway
    100672435 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100672435 (PLCB1)
   04916 Melanogenesis
    100672435 (PLCB1)
   04924 Renin secretion
    100672435 (PLCB1)
   04925 Aldosterone synthesis and secretion
    100672435 (PLCB1)
   04927 Cortisol synthesis and secretion
    100672435 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100672435 (PLCB1)
   04270 Vascular smooth muscle contraction
    100672435 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    100672435 (PLCB1)
   04971 Gastric acid secretion
    100672435 (PLCB1)
   04972 Pancreatic secretion
    100672435 (PLCB1)
   04973 Carbohydrate digestion and absorption
    100672435 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100672435 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100672435 (PLCB1)
   04725 Cholinergic synapse
    100672435 (PLCB1)
   04728 Dopaminergic synapse
    100672435 (PLCB1)
   04726 Serotonergic synapse
    100672435 (PLCB1)
   04720 Long-term potentiation
    100672435 (PLCB1)
   04730 Long-term depression
    100672435 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    100672435 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    100672435 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    100672435 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100672435 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100672435 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100672435 (PLCB1)
   05016 Huntington disease
    100672435 (PLCB1)
   05017 Spinocerebellar ataxia
    100672435 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100672435 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100672435 (PLCB1)
   04934 Cushing syndrome
    100672435 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100672435 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100672435 (PLCB1)
   05142 Chagas disease
    100672435 (PLCB1)
   05143 African trypanosomiasis
    100672435 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100672435 (PLCB1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100672435 (PLCB1)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100672435 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100672435 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 100672435
NCBI-ProteinID: XP_003411582
LinkDB
Position
Unknown
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRNAFLEKAYTKLKLQVTPEGRIPLKNVYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPELYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNHSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKTPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGIYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRVAVYEEGGKFIGHRILPVQAIRPGYHYISLRNER
NQPLMLQLFCLHRDFXDEMSPSYLDVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEIKK
EADPGETPSEAPNEARTTPAENGVNHTTSLAPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEDLKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNEYL
RRRAALEKTAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLMGVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILEEKP
KLQMELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPFQAPDPGKLNHKPPSS
EELEGDNQGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggagcccaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctgaagaagggcaccaaattcgtcaagtgggatgatgattccactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaataaggag
acggagctgttagacctcagccttgtcaaggatgccagatgtgggaaacacgccaaagct
cccaaggaccccaagttacgtgaacttttggatgtggggaacatcggacgcctggaacat
cgcatgataacagtggtgtatgggccggacttggttaacatctcccatttgaatctcgtg
gcttttcaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccaggaatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgcattcctctcaaaaatgtgtaccgcttgttttcagct
gaccggaagcgggtggaaactgcgttagaggcttgtagtcttccatcatcaaggaatgat
tcaatacctcaagaggacttcactccggaactgtacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttctgaatttggtgccaaaagtaaaccatacctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatccccggctaaacgaa
attctttacccacctttaaaacaagagcaagtccaagtattgatcgagaagtatgaaccc
aaccacagtcttgccagaaaaggacagatatctgtggatggatttatgcgctatctcagt
ggggaagaaaatggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cctctttctcactatttcattaattcctcgcacaacacctacctcacagctggccagttg
gctggaaactcctccgtagagatgtatcgccaagtgctcctgtctggttgtcgttgtgtg
gagctggactgctggaagggacggactgcagaagaggaacccgtcatcacccacgggttc
accatgacaactgaaatatccttcaaggaagtgatagaagcgatcgctgagtgtgcattt
aagacttcgccttttccaatcctcctttcctttgagaaccacgtggattccccaaaacag
caagccaagatggcggagtactgccgactgatatttggggacgcccttctcatggagcca
ctggaaaaatacccactggaatctggagtccctcttccaagccctatggacttgatgtat
aaaatcttggtgaaaaataaaaagaaatcacacaagtcgtcagaaggaagtggcaaaaag
aagctgtcggaacaagcctccaacacttacagcgactcgtccagcgtgttcgagccctcg
tctccaggagccggggaagctgatacggaaagtgatgacgatgatgacgacgatgactgt
aaaaagtcttccatggacgagggaactgctgggagcgaggccatggccacagaagagatg
tctaacctggtgaactatatccagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaacagaagttttgaaatgtcttctttcgtggaaaccaaaggactcgagcagcttacg
aagactccagtggaatttgtagaatacaacaaaatgcagcttagcagaatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagcttttctggaatgcgggttgtcag
atggttgcacttaacttccaaacagtggacttggctatgcaaataaatatggggatatat
gaatacaatgggaagagtggctacagattaaagccagagttcatgaggagacctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggccaacactttatctgtt
aagataatttcaggtcagtttctttctgataagaaagttggaacctacgtggaagtggat
atgtttggtttgcctgtggacacaaggaggaaggccttcaagaccaagacgtcacaagga
aatgcagtaaatcctgtctgggaagaagaacccattgtgttcaaaaaggtggtacttcct
tctctggcctgtttaagggtagcagtttatgaagaaggaggcaaatttattggtcaccgg
atcttgccagtgcaagcaattcgaccaggctatcactacatcagtctaaggaatgaaagg
aaccaacctctgatgctgcagctgttttgcctacatagagacttctgagatgaaatgtct
ccttcctatttagatgtgattgaagctttgtcaaacccaatccgatatgtgaatctgatg
gagcagagagctaagcaactagctgcgttgaccctggaagatgaagaagaaataaagaaa
gaggctgatcctggggaaacaccatcagaagctccaaatgaagccaggacaactccagca
gaaaatggagtgaatcacactacatcgctggcacccaaacccccctcccaggccctccac
agccagccagccccaggttctgtaaaggcacctgcgaaaacagaagatcttattcagagt
gtcctaacagaagtggaagcgcagactattgaagatctaaagcaacagaaatcatttgtg
aaactgcaaaagaagcactacaaagaaatgaaagacctggtgaagaggcaccacaagaag
accactgaccttatcaaagaacacactacaaaatacaatgaaattcagaatgagtacttg
cgaaggagggcagccttggaaaagactgccaaaaaggacagtaagaaaaaatcggaaccc
agcagtcctgatcatggttcatcaacgattgagcaagaccttgctgccctagatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacaatattacagtgaaaaataccagaagcgggaacatattaaactgcttattcag
aagttgatgggtgtggcagaagagtgtcagaacaaccagttgaagaagctcaaagagatc
tgtgagaaagagaagaaggaattaaagaagaaaatggataaaaagaggcaagaaaagata
acagaagccaaatccaaagacaaaagccagatggaagaggagaagacggagatgatccgg
tcatacatccaagaggtggtgcagtacatcaagaggttagaagaggcacaaagtaaacgg
caagaaaaacttgtagagaaacacaaggagatacgtcagcagatcctggaagaaaagccc
aagctacagatggaactggagcaagagtatcaagacaagttcaaaaggctgcccctggag
attttggagttcgtgcaggaagccatgaaagggaagatcagtgaagacagcaatcacagc
tctgcccctcccttccaggccccagaccctggaaaactgaaccacaaacctccctccagt
gaggagttggagggagacaaccaaggaaaagagtttgatactcctctgtga

DBGET integrated database retrieval system