KEGG   Loxodonta africana (African savanna elephant): 100663914
Entry
100663914         CDS       T04351                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav03440  Homologous recombination
lav04064  NF-kappa B signaling pathway
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04218  Cellular senescence
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05170  Human immunodeficiency virus 1 infection
lav05202  Transcriptional misregulation in cancer
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100663914 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100663914 (ATM)
   04068 FoxO signaling pathway
    100663914 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100663914 (ATM)
   04210 Apoptosis
    100663914 (ATM)
   04115 p53 signaling pathway
    100663914 (ATM)
   04218 Cellular senescence
    100663914 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100663914 (ATM)
   05206 MicroRNAs in cancer
    100663914 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100663914 (ATM)
   05170 Human immunodeficiency virus 1 infection
    100663914 (ATM)
   05165 Human papillomavirus infection
    100663914 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100663914 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100663914 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100663914 (ATM)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100663914 (ATM)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100663914 (ATM)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100663914 (ATM)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100663914 (ATM)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100663914 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 100663914
NCBI-ProteinID: XP_003415664
LinkDB
Position
Unknown
AA seq 3049 aa
MSLALNDLLICCRHLEHDRATERRKEVEKFKHLIRDPETVQHLDRHSDSKQGKFLNWDAV
FRFLQKYIQKETECLRTAKPNVSASTQSSRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSSNGAIYGADCSNILLKDILSVRKYWCEISQQQWLELLSVYFRLYFKPSQ
DINRVLVARIIYTVTKGCCSQTDALNPKFLDFFSKAIQCARQEKSSAGLNHVLAALIIFL
KTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQEK
GGYASTKWQSILYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIELVADICHQIFNEN
TRSLEISQSYTTTQRERSDHSVPCKRRRVELGWEVIKDQLQKSQNDFDLVPWLQIATQLI
SKYPASLPNCELSPLLIILCQLLPQQRRGERTPYVLRCLMEVALCQGKISNLESSQKSEL
LKLWFKIWCIAFRSISSEQTQAENFGLLGAIIQGSLVEVDREFWKLFTGSACRPSCPAVC
CLTVALTICVIPETAKARVEQNICEVNRSFSLRELIMKWLIFYQLEDDLEDSTELPPILH
SKFPHLSLEKILVSLTMKNCKAAMNFLQSAPECEQHQKSKEEPSFLEVEELFLRTTFDKM
DFLTIVKECATEKHQCSIGFSVHQNLKESLDRYLLALSEQLLNNYPSETTNSEVLVQCSS
LLVGVLGCYCYMGVIAEEEAYKSELFQKAKSLMQCAGESITMFKNKTNEESRIGSLRNVM
LLCTSCLCNCTKHNPNKITSGFFLRLLTSKLMNDIADICKSLVSFIRKPFDYGEVESMED
DSDENLVEVEDQSPVNLFDAAHESGESQSITGAISPLAEEYLSKQDLLFLDMLKFLCMCV
TTAQTNAVSFRAADIRRKLLMLIDSSTLDLTKSLHLHMYLVLLKELPGEDCPLPMEDVVE
FLKPLSNVCSLYRRDQEVCKTILNHVLHIIKNLSQGSLDNENTRDAQGQFLTVIGAFWHL
TKEGKCTSAVKVALVKCLKTLLEADPYSEWAILNVMGKDFPVNEVFPEFLADNHHQVRML
AAESVSRLFQDMKQQDSSRLLKALPLKLQQTAFENAYLKAQEGMREVSHSAENPELSDEL
YNRKAVLLMMIAVVLHCSPICEKQALFALCKSVKENGLEPHFIKKVLEKVSETFGYRHLE
DFMTSHLDYLVLEWLNHQDTEYSLSSFPFILLNYTNVENFYRSCYKVLIPHLVIRSHFDE
VKSIANQIQEDWKSLLTDCFPKILVNILPYFAYEGTGDSGMSQQRETAAKVYDMLKDESL
LGKQIDHLFISNLPEIVVELLMTLHEPANSGASHSTDLRDFSGDLDPAPNPPHFPSHVIK
ATFAYISNCHKTKFKSILEILSKSPDSYQKILLAICEQASETNNVYKKNRILKIYHLFVS
LLLKDIKSGLGGAWAFVLRDVIYTLIHYINKRPSRFMDVSLRSFSLCCDLLSRVCQTTVT
YCKDALESHLHVIVGTLIPLVGDQLEVQEQVLDLLKYLVIDNKDNENLYLTIKRLDPFPD
HVVFKDLRMTQQKIKYSRGPFSLLQEIKHFLSVSVYDALPLTRLEGLKDLRRQLEQHKDQ
MKDLMRASQENPQDGIVVKLVVSLLQLSKMAVNHTGEREVLEAVGSCLGELGPVDFSTIA
IQHSKDASYNKANELFEDKELQWIFIMLTHLNNTLVEDCVRVRSAAVTCLKSILATKAGH
NFWEIYKMTTDPILTYLQPFRTSRKKFLEVPRLNKENPLEDLDDPSLWTPQSENHDVWIK
TLTCAFLDSGGIKSEVLQLLKPMCEAKTDFCQTVLPYLIHDILLQDTNESWRNLLSTHIQ
GFFTNCFRHFSQTSQPTTPVNLDSESEHIFRGCMDKKSQRTMLAVVDYMRRQKRPCSGTV
FDDAFWLDLNYLEVAKVAQSCAAHFTALLYVEIYADRKNMDDQEKRSLIFEEGSQSTTIS
SLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRIRTYEHEAMWGKALV
TYDLETAITSSTRQAGIIQALQNLGLCHILSTYLRGLDHENKEWCAELQELHYQAAWRNM
QWDQCSSVNRELEGTSYHQSLYNALQSLRDREFSTFYESLKYARVKEVEELCKGSLESVY
SLYPTLSRLQAIGELENAGELFSRSVTDRQLSEVYVKWRKHSQLLKDSDFSFQEPIMALR
TVILEILMEKEMESSQRECFKDILTKHLVELSVLARTFKNTQLPERAIFQIKQYNSTSCG
VSEWQLEEAQVFWAKKEQSLALNILKQMIKKLDASCTENEPTLKLLYTECLRVCGNWLAE
TCLENPAVIMQTYLEKAVEVVGNYDGESSDELRNGKMKAFLSLARFSDTQYQRIENYMKS
SEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRALKEDRKRFLCKAV
ENYINCLLSGEEHDMWVFRLCSLWLENAGVAEVNGMMKRVGMKIPSYKFLPLMYQLAARM
GTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKPEAARRSRITKNA
PKQSSQLDEDRTEAANKIIHTIKSRRPQMVRNVEALCDAYILLANLDATQWKTQRKGINI
PADQPITKLKNLEDVVVPTMEIKVDPTGEYGNLVTIQSFKAEFRLAGGLNLPKIIDCIGS
DGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVPLSQRSGVL
EWCTGTVPIGEFLVNNEDGAHKRYRPKDFSAFQCQKKMMDMQKKSFEEKYETFMDICQNF
QPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQSAELVH
IDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSQETLLT
IVEVLLYDPLFDWTMNPLKALYLQQRPEDETELNPTLNADDQECKQNVSDIDQSFNKVAE
RVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9150 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcatctggaacatgacagggcc
acagaacgaaggaaagaagttgagaaatttaagcaccttattcgggatcctgaaacagtt
cagcatttagataggcattcagattccaaacaaggaaaatttttgaactgggatgctgtt
tttagatttctacagaaatacattcagaaagaaacagaatgcctgagaacagcaaaacca
aatgtatcggcttcaacacaatcctccaggcagaaaaagatgcaagaaatcagtagcttg
gtcaaatacttcattaaatgtgcaaataaaagagcacccaggctaaaatgtcaagaactc
ttgaattatatcatggatacagtgaaagattcatctaatggtgccatttatggagctgat
tgtagcaacatactgctcaaagatattctttcagtgagaaaatactggtgtgaaatatct
cagcaacagtggcttgaattgttgtctgtgtacttcaggttgtatttcaaaccatcacag
gacattaatagagttttagtcgccagaataatttacactgtgaccaaagggtgctgttca
caaactgatgcattaaatcccaaatttttggattttttttccaaggctattcagtgtgca
agacaagagaagagctctgcaggcctaaatcatgtcttagcagcccttattatcttcctc
aagactttggccgtcaactttcgaattcgagtgtgtgaattaggagatgaaattcttcct
acattgctttatatttggactcaacatagactcaatgattccttaaaagaagtgattatt
gaattatttcaactgcaaatttatatccatcatccaaagggagccaaaacccaagaaaaa
ggtggttatgcatcaacgaaatggcaaagtatcttatacaatttatatgatctgctagtg
aacgagataagtcatataggaagtagaggaaaatattcttcaggatctcgtaatattgct
gttaaggaaaacttgattgagttggtggcagatatttgtcaccagatttttaatgaaaat
accagatctttggagatttctcagtcttacactaccacacaaagagaacgtagcgatcac
agtgtaccttgcaaaaggaggagagtagaattaggctgggaagtaattaaagatcaactt
cagaaatcacagaatgattttgatcttgtgccttggttacagattgcaacccagttaata
tcaaagtatcctgcaagcttacctaactgtgagctatcaccattactgataatactatgc
cagcttctacctcaacagcgacgtggggaacgtacaccatatgtgttacgatgtcttatg
gaagttgcattgtgtcaaggcaagatttcaaatctagaaagctcacaaaagtcagagtta
ttgaaactctggtttaaaatttggtgtattgcctttcgcagtataagttctgaacaaaca
caagctgaaaactttggcttacttggagccataattcaaggcagtttagttgaagttgat
agagaattctggaagttatttactgggtcagcctgcagaccttcatgtcctgcagtatgc
tgtttgacagtggcactgaccatatgtgtaattccggaaacagcaaaagcaagagtagag
caaaatatctgtgaagtgaatagaagtttttcattaagggaattgataatgaaatggctc
atattctatcagttagaggatgacctagaagacagtacagagctgcctccaattcttcac
agtaagtttccgcatctttcactggagaaaattcttgtgagtctcactatgaaaaactgt
aaagctgcaatgaattttttgcaaagcgcaccagaatgtgagcaacatcaaaaaagtaaa
gaagagccttcattcttagaagtagaagaactgtttcttcggacaacttttgacaaaatg
gattttttgaccattgtgaaagaatgtgctacagaaaagcaccaatgcagcatcggattt
tctgtccaccaaaatctcaaggaatcactggatcgctatcttctggcattatcagaacaa
cttctaaataattacccatccgagactacaaattcagaagtacttgtgcagtgttcaagt
cttttggtgggtgttctcggctgctattgctacatgggtgtaatagctgaagaagaagcg
tataaatcagaattattccagaaagccaagtccctaatgcaatgcgcaggagaaagtatc
actatgtttaaaaataagacaaatgaggaatctagaattggttcattgagaaatgtgatg
cttctatgtacaagttgcttgtgcaactgtaccaagcacaatccaaataagatcacatct
ggcttttttctacgattgttaacatcaaagctaatgaatgacattgcagatatctgtaaa
agtttagtatcgtttatcagaaagccatttgactatggagaagtggaatcgatggaagat
gatagtgatgaaaatctagtggaggtggaggatcagtcacccgtgaatctgtttgatgct
gcacatgagtctggagagagccaaagcataactggtgccataagccctttagcagaagaa
tatctgtcaaagcaagatctgctttttttagacatgctcaagttcttatgtatgtgtgta
actaccgcccagaccaatgcagtatcattcagagcagctgatattcggcggaaactgtta
atgttaattgattctagcactctagatcttactaaatcccttcacctacacatgtatcta
gtgcttttgaaggagcttccaggagaagactgtcccttgccaatggaagatgttgttgag
tttctgaaaccactatccaatgtatgttctttgtatcgccgtgaccaagaagtttgtaaa
acaattttaaaccatgtccttcatataataaaaaacctgagtcaaggcagcctggacaat
gagaacaccagggatgctcaaggacagtttctaacagtaattggagcattttggcactta
acgaaggaggggaagtgcacgtctgctgtaaaggtggcgctagtgaaatgcctgaagact
ctgctcgaggctgatccttattcagaatgggctattctcaatgtaatgggaaaagacttc
cctgtaaatgaagtatttccagaatttcttgctgataatcatcaccaggttcgaatgttg
gccgcagagtcagtcagtagattattccaggatatgaagcaacaagattcttccaggtta
ttgaaagcacttcctttgaagcttcagcagacagcttttgaaaatgcatacttgaaagct
caggagggaatgagagaagtgtcccacagtgctgaaaacccggagctttctgatgagctt
tataatagaaaagccgttttactgatgatgatagctgtggttttacactgtagccctatc
tgtgaaaaacaggctttgttcgccctatgcaaatctgtgaaagagaatggattagaacct
cacttcattaaaaaggttttagagaaggtgtctgaaacttttggatatagacatctagaa
gatttcatgacttctcacttagattatctagttttggagtggctaaatcatcaagatact
gaatacagcttatcttcttttccttttattttattaaactacacaaatgttgagaatttc
tacagatcttgttacaaggttttgatcccacatctggtgattagaagtcattttgatgag
gtgaagtccattgctaatcagattcaagaggattggaaaagccttctaacagactgcttt
ccgaagattcttgtaaatattcttccttattttgcctatgagggtacaggagacagtggg
atgtcacaacaaagagagactgctgccaaagtctatgatatgctcaaagatgaaagcttg
ttaggaaaacagattgatcatttattcattagtaatttgccagagattgtggtggaatta
ttgatgacattacatgaaccagcgaattccggtgccagccacagcactgacctccgtgac
ttttcaggggacttggatcctgctcccaatccaccccattttccatctcatgtgattaaa
gcaacatttgcctacatcagcaattgtcataaaaccaagtttaaaagcattttagaaatt
ctttccaaaagcccagattcctaccagaaaattcttctagccatatgtgagcaagcatct
gagacaaataatgtgtataaaaagaatagaattcttaaaatatatcacctatttgttagt
ttattactgaaggatataaaaagtggcttaggaggagcttgggcctttgttcttcgagat
gttatttatactttgattcactatatcaacaaaaggccttctcgcttcatggatgtgtcc
ttacgtagcttctccctttgttgtgacctgttaagccgggtttgccagacaacagtgact
tactgtaaggatgctttagaaagccaccttcacgttattgttggtacacttatacccctt
gtgggtgatcagctggaggttcaggaacaggtattggacttgttgaaatacctagtgata
gataacaaggataatgaaaacctctatctcacaattaaacgtttagatccttttcctgac
catgttgtttttaaggatttgcgtatgactcagcagaaaatcaaatacagtagagggcct
ttttcactcttgcaggaaattaaacattttctttcagtaagtgtttatgatgcacttcca
ttgacaaggcttgaaggactgaaggatcttcggagacaactggagcaacataaagatcag
atgaaggatctgatgagagcttctcaggaaaacccacaagacggcattgtggtgaagctg
gttgtgagcttgttgcagctatccaagatggcagtaaatcacactggggaaagagaagtt
ttagaggctgttggaagctgtttgggagagttgggtcctgtagatttctcaaccatagct
atacaacatagtaaagatgcatcttataataaggccaatgagttatttgaagataaagaa
cttcagtggattttcataatgctgacccatctgaataatacactggtagaagattgtgtc
agagttcgatcagctgctgtcacctgtttgaaaagcattttagccacaaaagctggacat
aatttctgggagatttataagatgactactgatcccatactcacctatctacagcctttt
agaacatcgagaaaaaagtttttagaagtacccagacttaataaagaaaatcctttagaa
gacctggatgatccaagtttgtggactcctcaaagtgaaaatcatgatgtttggataaaa
acactgacttgtgcttttttggatagtggaggcataaaaagtgaagttcttcagttatta
aagccaatgtgtgaagcgaaaactgacttttgtcagacagtgcttccatacttgattcat
gatattttgctgcaagatacaaatgaatcgtggagaaatctgctttctacgcatattcag
ggatttttcaccaactgcttcagacatttctcacaaaccagccagcccacaacccctgtg
aatttggattcagagtcggaacacattttccgtggctgtatggataaaaaatcacaaaga
acaatgcttgctgttgtggactacatgagaagacaaaagagaccttgctcaggaacagtt
ttcgatgatgctttctggctggatttgaactatctagaggttgccaaggtcgctcagtcc
tgtgctgctcactttacagcattgctctatgtagaaatctatgcagatcggaaaaacatg
gatgatcaagagaaaaggagtcttatatttgaagaaggaagccagagtacaactatttct
agtttgagtgaaaaaagtaaagaagaaactggaataagtttacaggatcttcttttagaa
atctacagaagtataggagagccggatagcctgtatggctgtggtggagggaaaatgtta
caacctcttactagaataagaacatatgaacatgaagctatgtggggaaaagccttagta
acatatgacctcgagacagcaatcacctcatcaacccgccaggcaggaataattcaggcc
ctgcagaatttgggactctgccatatcctttccacctatttaagaggattagatcatgaa
aataaagagtggtgtgctgaactgcaggagcttcattaccaagcagcatggaggaatatg
cagtgggaccagtgcagttctgtcaacagagaactagaaggaaccagttatcaccaatca
ttgtacaatgctctgcagtctctaagagacagagagttttccacattttatgaaagtctt
aaatatgcaagagtgaaagaagtggaagagctgtgtaagggcagccttgagtctgtgtat
tcactctaccccacccttagcagattgcaggctattggagagctggaaaacgctggggag
cttttctcaagatcagtcacagataggcaactctctgaagtatatgtgaagtggcggaaa
cactcccagcttctcaaagacagcgattttagttttcaggagcctatcatggctctgcgc
acagtcattttggagatcctgatggaaaaggaaatggaaagctcccaaagagaatgtttt
aaagacattcttaccaagcaccttgtagaactctctgtactggcccgaactttcaagaac
actcagctccctgaaagggcaatatttcagattaaacagtataactcaactagttgtgga
gtctctgagtggcagctggaggaagcgcaagtgttctgggcaaaaaaggagcagagtctt
gctctgaatattcttaagcaaatgatcaagaagttggatgccagttgtacagagaatgaa
cctaccctaaaactgctatacacagaatgtttgagggtttgtggcaactggttagcggaa
acttgcttagaaaatcctgcagtcatcatgcagacctacctagaaaaggcagtggaagtt
gttggaaattatgatggagaaagcagtgatgagctcagaaatggaaaaatgaaggctttt
ctctcattagcacggttctcagatactcagtaccagagaattgaaaactacatgaaatca
tcagaatttgaaaacaagcaagctcttctgaaaagggccaaagaagaagtgggcctcctt
agggagcataaaattcagaccaacagatacacagtcaaggtccagcgagagctggagctg
gatgaatgtgcactccgtgcactgaaagaggaccgtaaacgtttcctgtgtaaagcagtt
gaaaattacatcaactgcttattaagtggagaagagcacgatatgtgggtattccgactt
tgttccctctggcttgaaaatgctggagttgctgaagttaatggcatgatgaagagagtt
ggaatgaagattccatcatataaatttttgcctcttatgtaccaattggctgctagaatg
ggaaccaagatgatggggggcctaggatttcatgaagtcctcaataatctcatctctaga
atctcaatggatcacccccatcatactttgtttattatactggccttagcaaatgccaat
aaagatgaatttctgaccaaaccagaggcagcaagaaggagtagaattacaaaaaatgca
cccaaacaaagctctcagcttgatgaggatcgaactgaagcggcaaacaaaataatacat
actatcaaaagtaggagacctcagatggtcagaaatgtcgaggcactttgtgatgcttat
attctactagcaaacttagatgccactcagtggaagactcagagaaaaggcataaatatt
ccagcagaccagccaattactaaacttaagaatttagaagatgttgttgtccccactatg
gaaattaaggttgaccccacaggagaatatggaaacctggtgactatacagtcgtttaaa
gcagaatttcgtttagcaggaggcttaaatttgccaaaaataatagattgtatcggctct
gatggcaaggaaaggagacagcttgtcaagggccgcgatgacctgagacaagatgctgtc
atgcagcaggtgttccagatgtgtaatacattactgcagagaaacactgaaaccagaaag
aggaagctgaccatctgcacatacaaggtggttcccctatctcagcgaagtggtgttctt
gaatggtgcacaggaactgtccccattggcgagtttcttgttaacaatgaagatggtgct
cataaaagatacaggccaaaggatttcagtgcctttcagtgccaaaagaaaatgatggac
atgcaaaagaagtctttcgaagagaaatatgaaactttcatggatatttgccagaatttt
cagccagttttccgttacttctgcatggaaaaattcttggacccagctgtttggtttgag
aaacggttggcttatacccgcagtgtggctacttcttctattgttggttatatacttgga
cttggcgatagacatgtacagaatatcttgataaatgaacagtcagcagaacttgtacat
atagatttaggagttgcttttgaacagggtaaaatccttcctactcctgaaacagttcct
tttagactcaccagagatattgtggatgggatgggcatcactggtgttgaaggtgtcttc
agaagatgctgtgagaaaactatggaggtcatgagaaactctcaggaaaccctgttaacc
attgtagaggtcctcctgtatgaccctctctttgactggaccatgaatcctttgaaagct
ttgtatttacagcagaggccagaagatgaaactgaactcaaccctactctgaatgcagat
gaccaggaatgcaaacaaaatgtcagtgatattgaccagagtttcaacaaagtagctgaa
cgtgtcttgatgagactgcaagagaagctgaaaggagtggaggaaggaactgtgctcagt
gtgggtggacaggtgaatttgctcatacaacaggctatggaccccaaaaatcttagccga
ctcttcccaggttggaaagcatgggtgtga

DBGET integrated database retrieval system