KEGG   Loxodonta africana (African savanna elephant): 100664204
Entry
100664204         CDS       T04351                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04520  Adherens junction
lav04530  Tight junction
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04972  Pancreatic secretion
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05100  Bacterial invasion of epithelial cells
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05231  Choline metabolism in cancer
lav05416  Viral myocarditis
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664204 (RAC1)
   04014 Ras signaling pathway
    100664204 (RAC1)
   04015 Rap1 signaling pathway
    100664204 (RAC1)
   04310 Wnt signaling pathway
    100664204 (RAC1)
   04370 VEGF signaling pathway
    100664204 (RAC1)
   04071 Sphingolipid signaling pathway
    100664204 (RAC1)
   04024 cAMP signaling pathway
    100664204 (RAC1)
   04151 PI3K-Akt signaling pathway
    100664204 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100664204 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100664204 (RAC1)
   04520 Adherens junction
    100664204 (RAC1)
   04530 Tight junction
    100664204 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100664204 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100664204 (RAC1)
   04620 Toll-like receptor signaling pathway
    100664204 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    100664204 (RAC1)
   04662 B cell receptor signaling pathway
    100664204 (RAC1)
   04664 Fc epsilon RI signaling pathway
    100664204 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    100664204 (RAC1)
   04670 Leukocyte transendothelial migration
    100664204 (RAC1)
   04062 Chemokine signaling pathway
    100664204 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    100664204 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100664204 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    100664204 (RAC1)
   04380 Osteoclast differentiation
    100664204 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664204 (RAC1)
   05205 Proteoglycans in cancer
    100664204 (RAC1)
   05203 Viral carcinogenesis
    100664204 (RAC1)
   05231 Choline metabolism in cancer
    100664204 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100664204 (RAC1)
   05212 Pancreatic cancer
    100664204 (RAC1)
   05211 Renal cell carcinoma
    100664204 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100664204 (RAC1)
   05020 Prion disease
    100664204 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    100664204 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100664204 (RAC1)
   05416 Viral myocarditis
    100664204 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100664204 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100664204 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100664204 (RAC1)
   05135 Yersinia infection
    100664204 (RAC1)
   05100 Bacterial invasion of epithelial cells
    100664204 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100664204 (RAC1)
   05163 Human cytomegalovirus infection
    100664204 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100664204 (RAC1)
   05169 Epstein-Barr virus infection
    100664204 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100664204 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664204 (RAC1)
   04031 GTP-binding proteins [BR:lav04031]
    100664204 (RAC1)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100664204 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100664204 (RAC1)
  Macropinocytosis
   Ras GTPases
    100664204 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100664204 (RAC1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100664204 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   100664204 (RAC1)
  Exosomal proteins of colorectal cancer cells
   100664204 (RAC1)
  Exosomal proteins of bladder cancer cells
   100664204 (RAC1)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100664204 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 100664204
NCBI-ProteinID: XP_023411724
LinkDB
Position
Unknown
AA seq 148 aa
MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLNCFSLVSPASFENVRAKWYPEVRHH
CPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRG
LKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 447 nt   +upstreamnt  +downstreamnt
atggtagatggaaaacccgtgaatctgggcttatgggatacagctggacaagaagattat
gacagactacgccccctctcctatccgcaaacagatgtgttcttaaattgcttttccctg
gtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaggtgcgacaccat
tgtcccaacactcccatcatcctcgtgggaactaaacttgatctgagggatgataaagac
acgattgagaagctgaaagagaagaagctgactcccatcacctacccccagggcttagca
atggctaaggagattggtgctgtaaaatacctggagtgctcagcgctcacgcagcgaggc
ctcaagacagtgtttgatgaagccatcagagccgtcctctgcccaccccctgtcaagaag
aggaagagaaaatgcctgctgttgtaa

KEGG   Loxodonta africana (African savanna elephant): 100670080
Entry
100670080         CDS       T04351                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04510  Focal adhesion
lav04520  Adherens junction
lav04613  Neutrophil extracellular trap formation
lav04650  Natural killer cell mediated cytotoxicity
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04670  Leukocyte transendothelial migration
lav04810  Regulation of actin cytoskeleton
lav05020  Prion disease
lav05135  Yersinia infection
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05231  Choline metabolism in cancer
lav05416  Viral myocarditis
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100670080 (RAC2)
   04014 Ras signaling pathway
    100670080 (RAC2)
   04015 Rap1 signaling pathway
    100670080 (RAC2)
   04310 Wnt signaling pathway
    100670080 (RAC2)
   04370 VEGF signaling pathway
    100670080 (RAC2)
   04071 Sphingolipid signaling pathway
    100670080 (RAC2)
   04024 cAMP signaling pathway
    100670080 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100670080 (RAC2)
   04520 Adherens junction
    100670080 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100670080 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100670080 (RAC2)
   04650 Natural killer cell mediated cytotoxicity
    100670080 (RAC2)
   04662 B cell receptor signaling pathway
    100670080 (RAC2)
   04664 Fc epsilon RI signaling pathway
    100670080 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    100670080 (RAC2)
   04670 Leukocyte transendothelial migration
    100670080 (RAC2)
   04062 Chemokine signaling pathway
    100670080 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    100670080 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670080 (RAC2)
   05231 Choline metabolism in cancer
    100670080 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100670080 (RAC2)
   05212 Pancreatic cancer
    100670080 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    100670080 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100670080 (RAC2)
   05416 Viral myocarditis
    100670080 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100670080 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100670080 (RAC2)
   05163 Human cytomegalovirus infection
    100670080 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:lav04031]
    100670080 (RAC2)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100670080 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 100670080
NCBI-ProteinID: XP_003419828
LinkDB
Position
Unknown
AA seq 195 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPHCPTVFDNYSANVMVDSKPVNLGLWD
TAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKL
DLRDDKDTIEKLKEKKLSPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVL
CPQPTRQQKRSCSLL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgcaagccatcaagtgtgtggtggtgggagacggagccgtgggcaagacctgccttctc
atcagctacaccaccaacgccttcccgggagagtacatcccccactgtcctaccgtgttc
gacaactactcagctaatgtgatggtggacagcaagccggtgaacttggggctgtgggac
acagctggacaggaggactacgaccgcctccggccgctctcctacccccagacggacgtc
ttcctcatctgcttctccctcgtcagcccagcctcctatgagaacgtcagagctaagtgg
ttccctgaggtacggcatcactgccccagcacccccatcatcctggtgggcaccaaactg
gacctgcgggatgacaaggacaccatcgagaagctgaaggagaagaaactgtcgcctatc
acctatccgcagggcctggcgctggctaaggagattgactcggtaaaatacctggagtgt
tcggccctcacccagcgaggcctgaaaactgtcttcgatgaggctatccgggccgtcctg
tgcccccaacccacgcgacagcagaaacgctcctgcagcctcctctag

DBGET integrated database retrieval system