KEGG   Loxodonta africana (African savanna elephant): 100664220
Entry
100664220         CDS       T04351                                 

Gene name
RAB11B
Definition
(RefSeq) ras-related protein Rab-11B
  KO
K07905  Ras-related protein Rab-11B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04152  AMPK signaling pathway
lav04962  Vasopressin-regulated water reabsorption
lav05164  Influenza A
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100664220 (RAB11B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100664220 (RAB11B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100664220 (RAB11B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100664220 (RAB11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100664220 (RAB11B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664220 (RAB11B)
   04031 GTP-binding proteins [BR:lav04031]
    100664220 (RAB11B)
Membrane trafficking [BR:lav04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    100664220 (RAB11B)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100664220 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   100664220 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   100664220 (RAB11B)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    100664220 (RAB11B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran Gtr1_RagA NTPase_1 SRPRB TniB AAA_14 FAD-SLDH AAA_24 Ploopntkinase3 AAA_5 AAA_21
Other DBs
NCBI-GeneID: 100664220
NCBI-ProteinID: XP_003421334
UniProt: G3TBL6
LinkDB
Position
Unknown
AA seq 218 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggacccgggacgacgagtacgactacctattcaaagtggtgcttattggggactcg
ggcgtggggaagagcaacctgctgtcacgcttcacccgcaacgagttcaacctggagagc
aagagcaccatcggtgtggagttcgccacccgcagcatccaagtggacggcaagaccatc
aaggcacagatctgggacacagctggccaggaacgctaccgcgccatcacttctgcgtac
taccgtggcgcagtaggcgctctgcttgtgtatgacatcgccaagcacctgacatatgag
aacgtggagcgctggctgaaggagctgcgggaccacgcagacagtaacattgtcatcatg
ctggtgggcaacaagagtgacctgcgccatctgcgggctgtgcccacggacgaggcccgt
gccttcgcagaaaagaacaacctgtccttcattgagacctcagccttggattccaccaac
gtagaggaagccttcaagaacatcctcacagagatctaccgcatcgtgtcacagaagcag
atcgctgaccgcgcagcccatgatgagtcccctggcaacaatgtggtggacataagcgtg
ccgcccactaccgacggacagaagcccaacaagctgcagtgctgccagaacctgtga

KEGG   Loxodonta africana (African savanna elephant): 100676260
Entry
100676260         CDS       T04351                                 

Gene name
RAB11A
Definition
(RefSeq) ras-related protein Rab-11A
  KO
K07904  Ras-related protein Rab-11A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04962  Vasopressin-regulated water reabsorption
lav04972  Pancreatic secretion
lav05164  Influenza A
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100676260 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100676260 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100676260 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100676260 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100676260 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100676260 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676260 (RAB11A)
   04031 GTP-binding proteins [BR:lav04031]
    100676260 (RAB11A)
Membrane trafficking [BR:lav04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    100676260 (RAB11A)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100676260 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   100676260 (RAB11A)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    100676260 (RAB11A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran NTPase_1 Gtr1_RagA SRPRB TniB AAA_14 AAA_24 FAD-SLDH MCM AAA_5 AAA_21
Other DBs
NCBI-GeneID: 100676260
NCBI-ProteinID: XP_003418421
UniProt: G3T7F3
LinkDB
Position
Unknown
AA seq 216 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctcttcaaagttgtccttattggagattct
ggtgttggaaagagtaacctcctgtctcgattcactagaaatgagtttaatctggaaagc
aagagcaccattggagtcgagtttgcaacaagaagcatccaggttgatgggaaaacaata
aaggcacagatatgggacacggcagggcaggagagataccgagctataacatcagcatac
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacgtatgaa
aatgtggagcgatggctgaaagaactgagggatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatttacgccatctcagggcggtccctacagatgaagcaaga
gctttcgcagaaaagaatggtttgtcattcattgagacgtctgctctagactctacaaat
gtagaagctgcttttcaaacaatcctgacagagatataccgcattgtttctcagaagcaa
atgtcagacagacgtgaaaatgacatgtctccaagcaacaatgtggttcctattcacgtg
ccaccaaccactgaaaacaagccaaaggtgcagtgctgtcagaacatataa

DBGET integrated database retrieval system