KEGG   Loxodonta africana (African savanna elephant): 100664296
Entry
100664296         CDS       T04351                                 

Gene name
NRG3
Definition
(RefSeq) LOW QUALITY PROTEIN: pro-neuregulin-3, membrane-bound isoform
  KO
K05457  neuregulin 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100664296 (NRG3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100664296 (NRG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100664296 (NRG3)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100664296 (NRG3)
SSDB
Motif
Pfam: EGF LapA_dom Laminin_EGF CCB1 Insulin_TMD YajC EGF_2
Other DBs
NCBI-GeneID: 100664296
NCBI-ProteinID: XP_010596547
LinkDB
Position
Unknown
AA seq 725 aa
MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAAAGGGLDGGGGGEGAAELSLELRCSD
CIVWNRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGIGQDPFFLS
KPSSFPKAMETTTATTSTTSPAAPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIR
ASPRSTTARNTASPPTVLSTTVPFFSSSTPSSRPPVPGTPSTPAMASWPTAAYATSSYLH
DSTPSWTLSPFQDAASSSSSSPSSVSTTATPETSTSPKFHTTTYSTERSEHFKPCRDKDL
AYCLNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEE
VYQRQVLSISCIIFGIVIVGMFCAAFYFKSKKQTKQIQEQLKETQNGKNYSLKVSGTMAK
SETLAKSHVQLQNYSKVERHPVTALEKMMESSFAGPQSFPDVPSSDRGSQSVKHHRSLSS
CCSPGQRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKII
SHLPIQLWCVESSLDLKYQSSGLKTQNNASINMQLPSRETNPYFKNLDQKDLVGYSSTRA
SSVPIIPSVGLEEACMQMPGISEVKSIKWCKNSYSADLVNVSIPVSDCLIAEQQEVKTLL
ETVQEQIRILTDSRQSEDYELASVETEDSVSENTAFLPLSPTAKSDRLAQFVLRNEIQRD
SASTK
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgagcgaaggcgcggccgctgcctcgccacctggtgccgcttcggcagccgccgcctcg
gccgaggagggcaccgcggcggctgcggcggcggcggcggcggcagcgggcgggggcctg
gacggcggcggcggcggcgaaggggcggccgagctctctctggagttacgctgtagcgac
tgcatcgtttggaaccggcagcagacgtggctgtgcgtggtacctctgttcatcggcttc
atcggcctggggctcagcctcatgctcctcaaatggatcgtggtgggctccgtcaaggag
tacgtgcccaccgacctggtggactccaaggggataggccaggaccccttcttcctctcc
aagcccagctccttccccaaggccatggagaccaccaccgcgaccacttcgaccacgtcc
cctgccgccccctccgccggcggcgccgcctcctccaggactcccaaccggattagcacc
cgcctgacgaccatcacacgggctcctactcgcttcccaggacaccgggtgcccatccgg
gccagcccgcgctccaccacggcacggaacactgcatcccccccgacggtcctgtccacg
acagtcccctttttcagcagcagcacaccaagctcccgccccccggtgccaggaaccccc
agtaccccggcaatggcctcctggcccactgcggcatacgctacctcctcctaccttcac
gactctactccctcctggaccctgtcccccttccaggatgctgcctcctcttcttcctcc
tctccttcctctgtctctaccaccgctacgccagaaactagcaccagccccaaatttcat
acaacgacatattccacagagcgctcagagcacttcaaaccctgccgagacaaggacctt
gcctactgcctcaacgatggcgagtgctttgtgatcgagaccctgaccggatcacacaaa
cactgtcggtgcaaagaaggctaccaaggagtccgttgcgatcaatttctgccgaaaaca
gattctatcctttcagatccaacagaccacctggggattgaattcatggagagtgaagaa
gtatatcaaaggcaggtgctgtcaatctcatgtatcatctttggaattgtcatcgtgggc
atgttctgtgcagcattctacttcaaaagcaagaaacaaactaaacaaatccaagagcag
ctgaaagagacacaaaatggcaaaaactacagtctcaaagtgtccggcacaatggcaaag
tcagagaccttggcgaagagccatgtccagctgcaaaactattccaaggtggaaaggcat
ccagtgacagcattggagaaaatgatggagtcaagttttgctggcccccagtccttccca
gacgtcccttcttccgacagaggaagccaatctgtcaaacaccacaggagtctctcctct
tgctgcagcccagggcaaaggagtgggatgctccataggaacgccttcagaaggacaccc
ccctcgccccgaagtcggctgggtggaatcgtgggaccagcatatcagcaactcgaagaa
tcaaggatcccagatcaggatacaataccttgccaagggatagaggtcaggaagattata
tcccacctgcctatacagctgtggtgtgttgaaagctccctggatttaaagtatcagtcc
agtggtttaaaaacccaaaacaatgcttcaataaatatgcaactgccttcaagagagacc
aacccctattttaaaaacttggatcaaaaggacctggtgggatattcatctacgagggcg
agttctgtgcccatcatcccttcagtgggtctagaggaagcctgcatgcaaatgccaggg
atttctgaagtcaaaagcatcaaatggtgcaaaaactcctactctgctgatcttgtcaat
gttagtattccagtcagtgattgtcttatagcagaacaacaagaagtgaaaacattgcta
gaaactgtccaagagcagatccgaattctgactgattccaggcagtcagaagactacgaa
ctggccagcgtagagactgaggacagtgtgagtgaaaacacagcctttctccccctgagc
cctacagccaaatcagatcgattggcacaatttgtcttaagaaatgaaatacaaagagac
tcggcatcgaccaagtga

DBGET integrated database retrieval system