KEGG   Loxodonta africana (African savanna elephant): 100664515
Entry
100664515         CDS       T04351                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X2
  KO
K05771  glucocorticoid receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100664515 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100664515 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100664515 (NR3C1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100664515 (NR3C1)
Nuclear receptors [BR:lav03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100664515 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100664515
NCBI-ProteinID: XP_003404624
UniProt: G3SVD4
LinkDB
Position
Unknown
AA seq 776 aa
MDSKESFKPPSREETLSSVLGRERGNVMDFYKTLRGGATVKIPASLPPLAAASPSDSKQQ
RLLVDFPKGSVSNEQQPDLSKAVSLSMGLYMGETEAKVMGSDLGFPQQGQISLSSGETDF
RLLEESIANLNKSTSVPENPKSSTSAAGSAASTEKEFPKTHSDVSSEQQNLKGQTGTNDG
NVKLYTTDQSTFDILQDLEFSGSPGKETNESPWRSDLLIDESCLLSPLAAEEESFLLEGN
SNEDCKPVVLPDTKPKIKDNGDLILSSPSSMPLPQVKTEKEDFIELCTPGVIKQEKLGPV
YCQSTFSGANIIGNKTSAISVHGVSTSGGQMYHYDMNTASHSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAAMGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKC
LQAGMNLEARKTKKKIKGIQQATAGVSQETSENPINKTVVPATLPQLTPTLVSLLEVIEP
EVLYSGYDSSVPDSTWRILTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWM
FLMAFALGWRSYRQAGGSLLCFAPDLVINEQRMSLPYMYDQCKHMLYVSSELQRLQVSYE
EYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKL
LDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLTEIISNQIPKFSNGKIKKLLFHQK
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggattccaaagaatcattcaaaccccccagtagagaagaaaccctcagcagtgtgctt
ggtcgcgagagaggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aagattcctgcatctttgcccccactggctgctgcttcaccgtcagactccaagcagcaa
agacttctggttgattttccaaaaggctcagtaagcaatgagcagcaaccagatctgtcc
aaagcagtttcactgtcaatgggattgtatatgggagagacagaagcaaaagtgatggga
agtgacttgggattcccacagcagggccaaatcagcctttcctctggggaaacagacttt
cggcttctggaagaaagcattgcgaacctcaataagtccaccagcgttccagagaacccc
aagagctcaacatctgccgctggttctgctgcctccacagaaaaggagtttccgaaaact
cactctgatgtgtcttcagaacagcagaatttgaagggccagactggcaccaacgatggc
aatgtgaaattgtacaccacagaccaaagcacctttgatattctgcaggatttggagttt
tctgggtccccaggtaaagagacaaatgagagcccttggagatcagacctcttgatagat
gaaagctgtttgctttctcctttggcagcagaggaggagtcattccttctagaaggaaac
tcaaatgaggactgcaagcctgtcgttttaccggacactaaacctaaaattaaggataac
ggagatctgatcttatccagccccagcagcatgccactgccccaagtaaaaacagaaaaa
gaagatttcattgaactgtgcactcctggggtaattaagcaagagaaactgggcccagtt
tactgtcagtcaaccttttctggagcaaatataatcggcaataaaacgtcggccatttct
gttcatggtgtgagtacttctgggggacagatgtaccactatgacatgaatacagcatcc
cattctcaacagcaggatcagaagcctatttttaatgtcattccgccaattcctgttggt
tcagaaaattggaataggtgccaaggatctggagatgacaacctgacttctttggggact
ttgaacttctctggtcgatcagttttttctaatggctattcaagccctggaatgagacca
gatgtaagctctcctccatccagctcttcagcagcgatgggaccacctcccaaactctgc
ctcgtgtgctctgatgaagcttcaggatgtcattatggggtcctgacttgtggaagctgt
aaagtgttcttcaaaagagcagtggaaggacagcacaattatctttgtgctggaagaaat
gactgtatcattgataaaattcgaagaaaaaactgcccagcatgccgctatcgaaaatgt
cttcaagctggaatgaacctggaagctcgaaaaaccaagaaaaaaataaaaggaattcag
caggccactgcaggcgtctcacaagaaacttcagaaaatcctattaacaaaacagtagtt
cctgcaacgttaccacagctcaccccaaccctggtgtcactgttggaggtcattgagcct
gaggtgttatattcaggatacgacagctctgttcctgactccacttggcgaatcttgacc
acactcaacatgttaggtggacggcaagtgatcgcagcagtgaaatgggcaaaggcgata
ccaggattcaggaacttacacctggatgaccaaatgaccctactgcagtactcatggatg
ttcctcatggcatttgccctgggatggagatcatatagacaagcaggtggtagcttgctg
tgttttgctcctgatctggttattaacgagcagagaatgtctctaccctacatgtatgac
caatgtaagcatatgctgtatgtttcctctgagttgcagagacttcaggtatcttatgaa
gagtatctgtgtatgaaaaccttactgcttctctcttcagttcctaaagacggcttgaag
agccaggagctgtttgatgaaattagaatgacctacatcaaagagctgggaaaggccatt
gtcaaacgggaaggaaactccagtcagaactggcaacgattttaccaactgactaaactc
ttggactccatgcatgatgtagttgaaaatctccttaactattgcttccaaacatttttg
gataagaccatgagtattgaattcccagagatgttgactgaaatcatcagcaatcagata
ccaaaattttcaaatggaaaaatcaaaaaacttctctttcatcaaaagtga

DBGET integrated database retrieval system