KEGG   Loxodonta africana (African savanna elephant): 100664947
Entry
100664947         CDS       T04351                                 

Gene name
STAR
Definition
(RefSeq) steroidogenic acute regulatory protein, mitochondrial
  KO
K16931  steroidogenic acute regulatory protein, mitochondrial
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04913  Ovarian steroidogenesis
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100664947 (STAR)
   04925 Aldosterone synthesis and secretion
    100664947 (STAR)
   04927 Cortisol synthesis and secretion
    100664947 (STAR)
  09154 Digestive system
   04979 Cholesterol metabolism
    100664947 (STAR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100664947 (STAR)
SSDB
Motif
Pfam: START Polyketide_cyc
Other DBs
NCBI-GeneID: 100664947
NCBI-ProteinID: XP_003412582
UniProt: G3SPT3
LinkDB
Position
Unknown
AA seq 285 aa
MLLATFKLCAGISYKHVLNMKGLRHQAVLTIGQELNRRALGGPTPSAWINQVRRRSSLLG
SRLEDSLYSDQEMAYIRQGEEAMQKALGILSNQEGWKKENQQANGDTVLSKVVPDVGKVF
RLEVVVDQPMERLYEELVDRMEAMGEWNPNVKEIKVLQKIGKDTVITHELAAESAGNLVG
PRDFVSVRCAKRRGSTCVLAGMATHFGEMPEQKGVIRGEHGPTCMVLHPLAGSPSKTKLT
WLLSIDLKGWLPKTIINQVLSQTQMDFANHLRHHLDSNLASEARC
NT seq 858 nt   +upstreamnt  +downstreamnt
atgctactagccacgtttaagctgtgtgctgggatctcttacaaacacgtcctcaacatg
aagggcctcaggcaccaagcagtgctgaccattggccaggagctgaaccggagggcactg
gggggcccaacccctagtgcatggattaaccaggtccgtcgtcggagctctctgcttggt
tcgcggctggaagacagtctctacagtgaccaggagatggcctacatccggcagggagag
gaagccatgcagaaggccttgggcatcctcagcaaccaggaaggctggaagaaggagaac
cagcaggcaaacggagacacagtgctgagtaaagtggtcccagacgtgggcaaggtattt
cggctggaggtggtggtagaccagcccatggagaggctctatgaagagcttgtggaccgc
atggaggcaatgggggagtggaaccccaatgtcaaggagatcaaggttctgcagaagatt
ggaaaagatacagtcatcacccatgagttggctgcagaatctgcaggaaacctcgtgggg
ccccgtgattttgtgagtgtgcgatgtgccaagcgccgaggctccacctgtgtgttggct
ggcatggccacacacttcggggagatgcctgagcagaaaggagtcatcagaggtgagcat
ggtcccacctgcatggtgcttcatcccctagctggaagtccttcaaagaccaaactcact
tggctactcagcattgacctcaaggggtggctgccaaagactatcatcaaccaggtccta
tcacaaacccagatggattttgccaaccatctgcgacaccatctggactccaacctggcc
tctgaagccaggtgttaa

DBGET integrated database retrieval system