KEGG   Loxodonta africana (African savanna elephant): 100665161
Entry
100665161         CDS       T04351                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100665161 (AURKA)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100665161 (AURKA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100665161 (AURKA)
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100665161 (AURKA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100665161 (AURKA)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100665161 (AURKA)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   100665161 (AURKA)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100665161 (AURKA)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100665161 (AURKA)
   Spindle formation proteins
    100665161 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    100665161 (AURKA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal MTBP_C Seadorna_VP7
Other DBs
NCBI-GeneID: 100665161
NCBI-ProteinID: XP_023394508
LinkDB
Position
Unknown
AA seq 407 aa
MDKSKENCISGPIKTTLPLGDGPKRVPVTQPFPSQNPLSASGGQAQRVLCPSNSSQSIPS
QAQKLVSSRKPVQSQKQKPLQITTVPRPVSRPPNNTPKGEQAQPPASGNNSGKELASKQK
KEESKRRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQVR
REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLQSSMSRELLRKSQY
ITELADALSYCHSKKVIHRDIKPENLLLGSTGELKIADFGWSVHAPSSRRTTLCGTLDYL
PPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEASTYQETYNRISRVEFTFPDLVTVGA
RDLVSRLLKHNPSQRLTLKEVLEHPWITANSKKPPSSQNKEPTSKQS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggataagtctaaggaaaactgcatttcaggacccattaagactacacttccacttggt
gatggtccgaagcgtgttccagtgactcagccattcccttctcagaacccattgtctgca
agtggtggccaggctcagcgggtcttgtgtccttcgaattcctcccagagcatcccttca
caagcacaaaagcttgtctccagccgaaagccagttcagagtcagaagcagaagccattg
cagataaccactgtacctcgtcctgtctccaggccacccaacaacaccccaaagggcgag
caggcccagccgccagcatctggaaataattctggaaaggaactggcgtcaaaacagaaa
aaagaagaatcaaaaagaaggcaatgggctttggaagattttgaaattggccgccccttg
ggtaaaggaaaatttggcaatgtttatctggcaagagaaaaacaaagcaagtttatcctg
gctcttaaagtattatttaaagctcagctagagaaagcaggagttgaacatcaggtgaga
agagaagtagaaatacagtcccacctcaggcatcctaacatcctcaggctgtacggttat
ttccatgacgccaccagagtttacctaatcctcgaatacgcacctcttggcacggtatac
agggaacttcagaagcttcaaagttcgatgagcagagaactgctccgtaagtcccaatat
atcacggaattggcagacgccctgtcttactgtcattccaagaaagttattcatagagac
attaagccggagaacctgctcctcggatccactggagagctgaagattgcagattttggg
tggtcggtgcatgccccgtcctccaggagaaccactctctgtggcacccttgactacctg
cctcctgagatgattgagggccgaatgcatgatgaaaaggtggacctctggagccttgga
gtcctttgctatgagttcttagttgggaagcctccttttgaggcgagcacataccaggag
acctataacagaatttcacgggttgagttcacattccctgacttggtaacagtgggagcc
agggacctggtctcaagattactgaagcataatccaagccaaaggctgacgctaaaagaa
gtacttgagcacccctggattacagccaactcgaaaaaaccaccaagtagccagaacaaa
gaaccaactagcaaacaatcttag

DBGET integrated database retrieval system