KEGG   Loxodonta africana (African savanna elephant): 100665691
Entry
100665691         CDS       T04351                                 

Gene name
ADM
Definition
(RefSeq) ADM isoform X2
  KO
K12333  adrenomedullin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100665691 (ADM)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100665691 (ADM)
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 100665691
NCBI-ProteinID: XP_003412215
UniProt: G3TF49
LinkDB
Position
Unknown
AA seq 188 aa
MKLVPVALMYLGLLAFLGADTTRLDVASEFGKKWNKWVLSRGKRDLRVSSSYSTGLADVK
AGPAQSLIRPQDVKGASRSPQTSNPDTARIRVKRYRQTMNNFQGLRGFGCRFGTCTVQKL
AHQIYQFTDKDKDDVAPRNKISPQGYGRRRRRSLPKGDGRWTLLSLEPQARGASASRAHR
VLTALLRI
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaagctggtgccggtagccctgatgtacttgggcttgctagctttcctaggcgccgac
actacgcggctcgacgtggcgtcggagtttgggaagaaatggaataagtgggttctaagt
cgtggaaagagggacctacgggtgtccagcagctactccaccggtctcgctgacgtgaag
gccgggcctgcccagagtctcattcggccccaggacgtgaagggagcctctcgaagcccc
cagaccagcaatccggacaccgcccgcatccgagtcaagcgctaccgccagaccatgaac
aacttccagggcctgcgaggcttcggctgccgcttcgggacgtgcactgtgcagaaactg
gcgcaccagatctaccagttcacggacaaggacaaagacgacgtcgcccccagaaacaag
atcagcccccagggctacggtcgccggcgccggcgctcccttcccaaaggagacgggcgc
tggactctgctgtcgctggagccacaggcgcgcggagcttcagcctcccgtgcgcaccga
gtgctcaccgccctactcaggatttaa

DBGET integrated database retrieval system