KEGG   Loxodonta africana (African savanna elephant): 100666000
Entry
100666000         CDS       T04351                                 

Gene name
IGFALS
Definition
(RefSeq) insulin-like growth factor-binding protein complex acid labile subunit
  KO
K17256  insulin-like growth factor-binding protein complex acid labile subunit
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100666000 (IGFALS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100666000 (IGFALS)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100666000 (IGFALS)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT LRRCT
Other DBs
NCBI-GeneID: 100666000
NCBI-ProteinID: XP_023413040
LinkDB
Position
Unknown
AA seq 586 aa
MGCGGLEGMDPRTPRDAESLRCPTMCVCNYDDYTDELNVFCSARNLTRLPTGIPEGTRAL
WLDCNNLTSIPAAAFQNLSGLDFLNLQGSQLGSLEPHALLGLGALYHLHLEQNQLRSLAA
GTFSHTPGLASLSLHHNLLSRLDEGIFASLPHLWALNLGWNGLAVLPDTAFQGLAGLREL
VLAGNRLIYLQPPLFCGLDELQELDVSRNALRSVKAGVFVKLPKLQKLYLHHNLITSVAP
GAFLGLRALRWLDLSHNRVGGLFAETFPGLLGLRVLRLSHNALTGLRPRTFKDLHFLEEL
QLGHNRIRQLAEHTFQGLGQLEVLTLDHNQLQELRPGAFLGLANVAVMNLSGNCLRNLPE
QVFRGLGQLHSLHLEGSCLGRVRPHTFLGLGGLRRLFLRDSSIMDLDEQSLQGLPELLEL
DLTANCLAHLPRQLFQGLGKLEYLLLAHNQLVELTLDTLRPLQRTFWLDLAHNRLEGLAE
GVLAPLEQLRYLSLGNNSLHTFLPQPPGLEHLWLEGNPWDCGCALQALWAFALKNPRAVP
RAVQVVPEGDDRQPPVYTYNNITCAGPPAVAGLDLRDLREAHFAHC
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgggctgtggcggcctggaaggcatggatcccagaacaccgagggacgctgagagcctg
cggtgccctaccatgtgtgtctgcaactacgacgattacacagatgagctcaatgtcttc
tgcagtgcccgaaacctcacacggctgcccactggcatccctgagggcaccagggccctg
tggctggactgcaacaacctaaccagcatccccgcggctgccttccagaacctctcaggc
ctggacttcctcaacctgcagggcagccagctgggcagcctggagccacacgcgctcctg
ggcctgggcgcgctctaccaccttcatctagagcagaaccagctgcgcagcctggcggct
ggcaccttttcacacacgccaggcctggcctccctcagcctgcaccacaacctgctcagc
aggctggacgagggcatcttcgccagcctgccgcacctctgggccctcaaccttggctgg
aatggcctggctgtgctgcctgacactgccttccagggcctggctggtctgcgtgagctg
gtactggctggcaaccgcctgatctacctgcagccgccgctcttctgcggcctggatgag
ctgcaggagctggacgtgagccgcaatgcactgcgcagcgtcaaggccggcgtctttgtc
aagctgcccaagctgcagaagctctacctgcaccacaacctcatcaccagcgtggcaccc
ggtgccttcctgggcttgcgtgccctgcgctggctggacctgtcgcacaaccgtgtgggc
ggcctctttgcagagaccttccctggcctgctggggctacgtgtgctgcgcctctctcac
aatgcgctgaccggtctgcggccacgcaccttcaaagacctacactttctggaggagctg
cagcttggccacaaccgcatccggcaactggctgagcacaccttccagggcctgggccag
ctggaggtgctcacgctggaccacaaccagctccaggagctgcggccaggtgccttcctg
gggctcgccaacgtggccgtcatgaacctctcgggcaactgcctgcggaacctgccggag
caggtgttccggggcttgggccagctgcacagcctgcacctggagggcagctgcctgggc
cgtgtgcgcccgcacaccttcttgggcctggggggcctgcgccggctcttccttcgagac
agcagcatcatggatcttgacgagcagagcctgcaggggctgcctgagctgctcgagctg
gacctcaccgccaactgcctggcgcacctgccgcgccaactcttccagggccttggcaag
ctcgagtacctgttgctggcccacaaccagctggtggagctcaccctggacacgctccgg
cccctgcagcgcaccttctggctggacttggcacacaaccgcctggagggcttggccgag
ggtgtcctggcgcccctggagcagctgcgctacctcagtctgggcaacaactccctgcac
accttcctgccgcagccccctggcctggagcacctgtggctcgagggcaacccctgggac
tgtggctgtgcgctgcaggcactgtgggccttcgccctgaagaacccccgcgccgtacca
cgcgctgtgcaggtggtccccgagggtgatgaccgccagccgcccgtgtacacctacaac
aacatcacctgtgcaggtccacctgctgtggctggccttgacctgcgggacctccgcgag
gcccactttgctcactgctga

DBGET integrated database retrieval system