KEGG   Loxodonta africana (African savanna elephant): 100666129
Entry
100666129         CDS       T04351                                 

Gene name
KCNQ1
Definition
(RefSeq) LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily KQT member 1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04725  Cholinergic synapse
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100666129 (KCNQ1)
  09154 Digestive system
   04971 Gastric acid secretion
    100666129 (KCNQ1)
   04972 Pancreatic secretion
    100666129 (KCNQ1)
   04974 Protein digestion and absorption
    100666129 (KCNQ1)
  09156 Nervous system
   04725 Cholinergic synapse
    100666129 (KCNQ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666129 (KCNQ1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100666129 (KCNQ1)
SSDB
Motif
Pfam: Ion_trans Ion_trans_2
Other DBs
NCBI-GeneID: 100666129
NCBI-ProteinID: XP_023397355
LinkDB
Position
Unknown
AA seq 1099 aa
MAQENCTLWLQPAPPPAAAGTYPPTSPPSDRRLSDSRSPHSAWYRRGPPSLQMHTEPLLS
AGSTLGWGEGGEELEPYSADQEADRPPGCSVKIWKWLSNAPERPAFFCRPSPAPSVGGAS
SKGSRGSSAGDPRRPRDHPLQSPTLSRPFQGNTRSAAAARSPAARPLPVGRFISPPWLAP
RAPAGTQGSLRPLRLHRDAPSEGGRVGAGALPRLPSRQRGSRPLHLPPVAILRAPLGGPH
PTGPSRWQPEMAYVLGLAPMFSLDPRVSFYRRTTPASDATHFQGRRLNFLERPTGWKCFV
YHFAVFLIVLVCLIFSVLSTIEQYATLAMGTLFWMEIVLVAFFGTEYVVRLWSAGCRSKY
VGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVVRQ
GGNWKLLGSVVFIHPQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSYADALW
WGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHF
NRQIPAAASLIQTAWRCYAAENPESSTWKIYVRKPARNHTLLSSSPKPKKSVMVKKKKFK
LDRDNGVGPGEKTLTVPHITYDPVGDDRRADRLSLDGYDGTVKKSPTLLDVSTTHFMRTN
SFTEDLDLEGETLLVPITHISQLREHHRVTIKVIRRMQYFVAKKKFQVSAYHTPDLDRGP
GHDFCGGPVGALLEASDLPFQAICFPPRRLDQSIGKPSLFISVSEKNKDRGNNTIGARLN
RVEDKVGASVLATVALAGSRAWFLVIAVVGAHTVLTTAASPTPGSVLSVYKRLGWCLWGS
SSFLPPYLLPSFLPSIPSSLHPFLLLDCLRTLGSRTLHPHQPGPRMPATSLPSQEPLPSI
YPGAMGRPGAWEALSQAHWALLPLKSLWSGAGVISPNSESVYTVYLEVSKRLKIEEFGWA
PECGCPRLPGQRLALAHVHRCRRWVGGEQDGARTAAPGTASSKPASPILGSGLPLSIIST
ELAHALTQAVCSLGTVPTSQVGSETQERLRAVGSPHEHPGKAASADGPLPRAGNVAASAT
LRGLGIWGSAHSITGRAAL
NT seq 3300 nt   +upstreamnt  +downstreamnt
atggcccaggagaactgcaccctctggctgcagcctgcccccccacccgctgccgcaggg
acctacccccccacctccccgccctccgaccgtcgcttaagcgactccaggagtccccac
agtgcctggtacaggcggggacccccttctctgcagatgcacacggagccgctgctgagt
gcaggcagcaccctggggtggggagagggtggggaggagctggagccctactctgcagat
caagaagctgaccgcccaccggggtgctcagtgaagatctggaagtggctgagcaatgcc
ccagaaagaccagccttcttttgccgcccttcccccgccccatcagtagggggagccagt
agcaagggcagcaggggcagcagcgcaggggacccgcgcagacctcgggaccacccactg
cagtcgcccacgctgtcccgccccttccaggggaacacacgaagcgcagcggcagccagg
tctcccgcggcccgacccctgcctgtgggccgcttcatctcgcccccctggttggccccc
cgcgccccggccggcacccaagggtcgctcagaccgctcaggctgcaccgggacgctccc
tccgagggtgggagagtgggtgcgggcgccctaccccgcctcccatctaggcagcgcggt
tctcggcctctgcacctgccgcccgtagctatccttcgcgccccgctagggggtccgcac
cccaccgggccaagcaggtggcagcccgagatggcatatgtgctaggtctggcgcctatg
ttcagcctggacccgcgagtttccttctacagacgcaccacgcccgctagtgatgccacc
cacttccaaggccggcgtctcaacttcctcgagcgccccacaggctggaagtgcttcgtc
taccactttgccgtcttcctcatcgtcctggtctgcctcatcttcagcgtgctgtctacc
attgagcagtacgccactctggccatggggaccctcttctggatggagatcgtgctggtg
gcgttctttggcacagagtacgtggtgcgcctctggtcggccggctgccgcagcaagtat
gtgggcatctgggggcggctgcgctttgcccggaagccaatttccatcatcgacctcatc
gtggtggtggcctccatggtggtcctctgtgtgggctccaaaggacaggtgtttgccacc
tcagccatcaggggcatccgcttcctgcagatcctgaggatgctgcacgtggtccgccag
ggtggcaactggaagctgctgggctccgtggtcttcatccacccccaggagctgatcacc
accctgtacatcggctttctgggcctgatcttctcgtcctacttcgtgtacctggccgag
aaggacgccgtgaacgagtcaggccgcgtggaattcggcagctatgctgacgcgctgtgg
tggggcgtggtgacagtcaccaccatcggctacggggacaaggtgccgcagacttggatc
ggcaagaccatcgcctcctgcttctctgtctttgccatctccttctttgcgctccctgcg
ggcatcctgggctctgggttcgccctgaaggtccagcagaagcagcggcagaagcacttc
aaccggcagatcccagcagccgcctcacttatccagactgcgtggaggtgctacgcggct
gagaaccccgagtcctccacctggaagatctacgtgcgcaagcccgcccgcaaccatacc
ctgctctcctccagccccaagcccaagaagtccgtcatggtcaaaaaaaagaaattcaag
ctggaccgggacaacggggtgggccctggggagaagacgctcacggtcccgcacatcacc
tacgacccagtcggggatgatcgcagggctgaccgcctgtccctcgatggctacgacggt
actgtgaagaagagccccacactgctggatgtgagcacaacccacttcatgcggaccaac
agcttcaccgaggacctggacctggagggggagacgctgttggtgcccatcacccacatc
tcacagctccgggagcaccatcgggtcaccatcaaggtcatccgacgcatgcagtacttt
gtggccaagaagaaattccaggtgagtgcataccacacccctgacctagacaggggccct
ggacatgacttctgtggggggccagtgggggcacttctggaagcctcagatttgcccttc
caagctatctgttttcctccccgcaggctggaccagtccatcgggaagccctccctgttc
atctccgtctcagaaaagaacaaagaccgtggcaacaacacaatcggcgcccgcctaaac
cgagtggaagacaaggtaggtgcgagcgtcctggccacagtggctctggcaggcagcaga
gcgtggttcctcgtgattgctgttgttggcgcccacacagtgctgaccacagcagcgtct
cccactcctggttctgtcctgagtgtgtacaagagacttggatggtgcctatgggggtct
tcttccttccttcctccctacctccttccatccttcctcccttccatcccttcctccctc
catcccttccttctcttggactgcctgcgcaccctcggctccaggaccctccacccacac
caaccaggccccaggatgcccgccaccagccttccctcccaggagccccttcccagcatc
tatccaggagccatgggaaggcctggggcctgggaggccctttctcaggcccactgggcg
ctgctgcctttgaagtctctgtggtctggagcgggcgttatctcgccaaacagcgagtct
gtctacacagtttatctggaagtatccaagaggctaaaaatagaggaattcggttgggcc
ccagagtgcggctgccctcggttgcccgggcaacgcctggctctggcccacgtccaccgt
tgccgccgctgggtgggcggggagcaggacggtgcacgcaccgctgctcctgggacagcc
agctccaagcctgccagccccatcctggggtctggcctccctctgtccatcatcagcaca
gagctggcacacgcccttacccaggcagtgtgttccctggggaccgtccccaccagccag
gtgggatctgagacccaggagagactccgggctgtgggctcaccccatgaacaccctggc
aaggcagcctctgctgatgggcctctgcccagagctgggaatgtggcagcctctgccaca
ctgcgtgggctgggcatctggggctctgcccacagcatcacaggacgggctgccctgtaa

KEGG   Loxodonta africana (African savanna elephant): 100666451
Entry
100666451         CDS       T04351                                 

Gene name
KCNE1
Definition
(RefSeq) potassium voltage-gated channel subfamily E member 1
  KO
K04894  potassium voltage-gated channel Isk-related subfamily E member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100666451 (KCNE1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666451 (KCNE1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100666451 (KCNE1)
SSDB
Motif
Pfam: ISK_Channel
Other DBs
NCBI-GeneID: 100666451
NCBI-ProteinID: XP_023403946
LinkDB
Position
Unknown
AA seq 129 aa
MTLSNTTAVMPFLTRLWQEVVPQGSNASSLARRSTSGHNRELEALYILIVLGFFGFFTLG
IMLSYIRSKKLEHSHDPFNVYIESDTWQEKDKAYFQARILESYKACYVIENQLTVEEPNT
YLPETKPSS
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaccctgtctaacaccacggccgtaatgccctttctgaccaggctgtggcaggaggtg
gttccacagggcagcaacgcgtctagcctagcccgtcggtctaccagcggtcacaacagg
gagctggaggcgctgtacattctcattgtgctcggcttcttcggcttcttcaccctgggc
atcatgctgagctacatccgctccaagaagctggagcactcccatgaccctttcaatgtg
tacatcgagtcagacacctggcaggagaaggacaaggcgtacttccaggcccggattctg
gagagctacaaagcgtgttatgtcattgagaaccagctgaccgtagaagaacccaatacc
taccttcctgagacgaagccttcctcctga

DBGET integrated database retrieval system