KEGG   Loxodonta africana (African savanna elephant): 100666885
Entry
100666885         CDS       T04351                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04141  Protein processing in endoplasmic reticulum
lav04151  PI3K-Akt signaling pathway
lav04211  Longevity regulating pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04668  TNF signaling pathway
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04915  Estrogen signaling pathway
lav04918  Thyroid hormone synthesis
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav05020  Prion disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100666885 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100666885 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100666885 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100666885 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100666885 (ATF6B)
   04915 Estrogen signaling pathway
    100666885 (ATF6B)
   04926 Relaxin signaling pathway
    100666885 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100666885 (ATF6B)
   04918 Thyroid hormone synthesis
    100666885 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100666885 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100666885 (ATF6B)
   04927 Cortisol synthesis and secretion
    100666885 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100666885 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100666885 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100666885 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100666885 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100666885 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100666885 (ATF6B)
   05031 Amphetamine addiction
    100666885 (ATF6B)
   05034 Alcoholism
    100666885 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100666885 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100666885 (ATF6B)
   05161 Hepatitis B
    100666885 (ATF6B)
   05163 Human cytomegalovirus infection
    100666885 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100666885 (ATF6B)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100666885 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB YabA GIT_CC HALZ Docking
Other DBs
NCBI-GeneID: 100666885
NCBI-ProteinID: XP_010599828
LinkDB
Position
Unknown
AA seq 708 aa
MVGGWGEKMAELMLLSEIADPTRFFTDNLLSPEDWDCTLYTGLDEVAEEQTQLFRCLEQD
VPFDSSSLDVGMDASPPEPPWDPLPIFPDLEVKSEPSSPCSSSSLSSESSHLSTEPSSQA
PGVGEVLDVKTESLVPPFCLLGDGPTSPFGTVQINVGLTSDDPSDVRTKIEPVSPSSSIN
SEASLLSAESPSQALIGEEVLEVKTESPSPPGCLLRDVPTPPFGAVQISMGPSPDGSSGK
ALPTRKPPLQPKPVMITTVPLPPRAVPPSTTVLLQHLVQPPPVSPVVLIQGAIRVQPEGP
THPVARPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEA
RLQAVLSDNQQLRRENAALRRQLEALLAKNSELKLGSGNRKVVCIMIFLLFIAFNFGPVS
ISEPPLAPVSPQVSGEEPRLRRHLLEFSEQEPVRGVSPLQGSSQGPEEPEPSPASRPSFR
NLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQ
ERQKSQLRKESPPVKAVPTRPLGPPERGSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVI
HIKTSTVPPSLRKQPSPTPGNATGGPLPASTASQAHQASHQPLYLNHP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggttggggggtggggggaaaagatggcggagctgatgctcctcagcgagattgccgac
ccgacgcgtttcttcacggacaacctactgagcccggaggactgggactgtaccctgtac
actggcctggatgaagtggccgaggagcagacgcagctcttccgttgcctggagcaggat
gtcccgttcgacagcagctctctggatgtggggatggatgccagtccccctgagccccca
tgggaccccttacctatcttcccagatcttgaggtgaagtctgaaccatcctccccgtgc
tcttcctcctccctcagttctgaatcatcacatctctccacggaaccctccagccaggct
cctggtgtaggggaggtgctggatgtgaaaacagagtccttagtgcccccattctgcctc
ctgggagatggtccaacatccccatttggaaccgtccagatcaatgtgggccttacctct
gatgatccttcagatgtacggaccaagatagagcctgtctccccttcttcctccatcaac
tcagaggcttccctgctctcagcagagtcccccagccaggccctcataggagaggaggta
ctggaagtgaagactgagtccccatccccaccagggtgcctcctgcgggatgttccaacc
cccccatttggagctgtccagatcagcatgggcccatcccctgatggctcctcaggcaaa
gccctgcccacacggaaaccgccactgcagcctaaacctgtgatgataaccactgtcccg
ctgccacccagagctgtgccgcctagcaccaccgtccttcttcagcacctcgtccagcca
cccccagtgtccccagttgtccttatccagggtgctattcgagtccaacctgaggggccg
acccaccctgttgcacgacctgagaggaagagcatcgtcccagctcctatgcctgggaac
tcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcggatgattaagaac
cgggagtcggcctgccagtcccgcaggaagaagaaagagtatctgcaggggctggaggca
aggttgcaggcggtgctgtccgataaccagcagctgcgtcgggagaatgctgccctccgc
cggcagctcgaggccctgctggctaagaacagtgagctcaagttggggtctggaaacagg
aaggtggtctgcatcatgatcttcctcctcttcattgccttcaactttgggcctgtcagc
atcagtgagcctcctttggctcctgtctctcctcaagtgagcggagaggaacctcggctc
cggaggcacctgctggagttctcagagcaagagccagttcgtggagtctcacccctccag
ggctcctcccaggggcctgaagagcccgagcccagccctgcaagccgaccgagttttagg
aatctgacagccttccctgggggtgccaaggagctgctactgagagacctggaccagctc
tttctctcctccgattgccgtcactttaaccgaacggagtccctgaggcttgcagatgag
ttgagtggctgggtccagcgccaccagagaggccggcggaagatccctcagagggcccaa
gagagacagaagtctcagctacggaaggagtcgcctccagttaaagcagtccccactcga
ccactggggcccccagaaaggggttctgtgggccaactgcagctgtatcgccacccagac
cgttcccagccagagttcctggatgcaatcgaccgacgggaagacacattttatgttgtc
tcctttcgaagggaccacttgctgctcccagccatcagccacaataagacctcccggcct
aagatgtctctggtgatgcctgccatggcccccaatgagactctttcgggccgcggagcc
ccaggggactatgaggagatgatgcagatcgagtgcgaggtcatggacaccagggtgatt
cacatcaagacctccacggtgcccccctcgctccgaaagcagccgtccccgacccccggc
aatgccacagggggccccttgccagcttctacagccagccaggcccaccaggcctcccac
caacccctctacctcaatcacccctga

DBGET integrated database retrieval system