KEGG   Loxodonta africana (African savanna elephant): 100668413
Entry
100668413         CDS       T04351                                 

Gene name
RAB5B
Definition
(RefSeq) ras-related protein Rab-5B
  KO
K07888  Ras-related protein Rab-5B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
lav05146  Amoebiasis
lav05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100668413 (RAB5B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100668413 (RAB5B)
   04145 Phagosome
    100668413 (RAB5B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100668413 (RAB5B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100668413 (RAB5B)
   05152 Tuberculosis
    100668413 (RAB5B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100668413 (RAB5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100668413 (RAB5B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100668413 (RAB5B)
   04031 GTP-binding proteins [BR:lav04031]
    100668413 (RAB5B)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100668413 (RAB5B)
 Endosome - Lysosome transport
    100668413 (RAB5B)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100668413 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   100668413 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   100668413 (RAB5B)
  Exosomal proteins of melanoma cells
   100668413 (RAB5B)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100668413 (RAB5B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 100668413
NCBI-ProteinID: XP_003405165
LinkDB
Position
Unknown
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag
ttcaaattagtcctgctgggggaatctgcagtggggaagtctagcctggtattacgtttt
gtcaaagggcagttccacgagtaccaggagagtaccattggagcggccttcctcacccag
tccgtttgtctagatgacacaacagtcaagtttgaaatctgggacacagctgggcaggag
cgataccatagcttggcccctatgtactacaggggtgcccaagctgcaattgtggtttat
gacattactaatcaggaaacctttgcccgagcaaagacatgggtaaaggaactacagcga
caggccagtcctagcatcgttattgccctggcaggaaacaaagctgacctggccaacaag
cgcatggtggaatatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg
gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag
ctgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat
ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

KEGG   Loxodonta africana (African savanna elephant): 100669020
Entry
100669020         CDS       T04351                                 

Gene name
RAB5C
Definition
(RefSeq) ras-related protein Rab-5C
  KO
K07889  Ras-related protein Rab-5C
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
lav05146  Amoebiasis
lav05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100669020 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100669020 (RAB5C)
   04145 Phagosome
    100669020 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100669020 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100669020 (RAB5C)
   05152 Tuberculosis
    100669020 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100669020 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100669020 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100669020 (RAB5C)
   04031 GTP-binding proteins [BR:lav04031]
    100669020 (RAB5C)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100669020 (RAB5C)
 Endosome - Lysosome transport
    100669020 (RAB5C)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100669020 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   100669020 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   100669020 (RAB5C)
  Exosomal proteins of bladder cancer cells
   100669020 (RAB5C)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100669020 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 100669020
NCBI-ProteinID: XP_003414284
LinkDB
Position
Unknown
AA seq 216 aa
MAGRGGAARPNGPASGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggtgcagcacgacccaacggaccagcctctgggaacaagatctgc
caatttaagctggtcctgctgggggaatctgcggtgggcaaatccagccttgtcctccgc
tttgtcaagggccaattccacgagtaccaggagagcacaattggagcggccttcctcaca
cagactgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag
gagcggtatcacagtctggcccccatgtattatcggggggcccaggccgccatcgtggtc
tatgacatcaccaacacggatacatttgcacgggccaagaactgggtaaaggagttacag
aggcaggccagccccaacatcgtcatcgcacttgcgggcaacaaggcggacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagatgacaacagtttgctgttc
atggaaacatcagcaaagactgcaatgaatgtgaatgaaattttcatggcaatagctaag
aagcttcccaagaacgagccccagaatgctgctggtgctccaggccggaaccgaggcgtg
gaccttcaggagaacaacccagccagccggagccagtgctgcagcaactga

KEGG   Loxodonta africana (African savanna elephant): 100676912
Entry
100676912         CDS       T04351                                 

Gene name
RAB5A
Definition
(RefSeq) ras-related protein Rab-5A
  KO
K07887  Ras-related protein Rab-5A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04962  Vasopressin-regulated water reabsorption
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05146  Amoebiasis
lav05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100676912 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100676912 (RAB5A)
   04145 Phagosome
    100676912 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100676912 (RAB5A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100676912 (RAB5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100676912 (RAB5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100676912 (RAB5A)
   05152 Tuberculosis
    100676912 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100676912 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100676912 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676912 (RAB5A)
   04031 GTP-binding proteins [BR:lav04031]
    100676912 (RAB5A)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100676912 (RAB5A)
 Endosome - Lysosome transport
    100676912 (RAB5A)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100676912 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   100676912 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   100676912 (RAB5A)
  Exosomal proteins of bladder cancer cells
   100676912 (RAB5A)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100676912 (RAB5A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 100676912
NCBI-ProteinID: XP_003415780
UniProt: G3T1K9
LinkDB
Position
Unknown
AA seq 215 aa
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSTRGRGVDLTEPTQPTRSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag
ttcaaactagtgcttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt
gtgaagggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccag
actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagag
cgataccacagcctagcaccaatgtactacagaggagcacaagcagccatcgttgtatat
gatatcacaaatgaggaatcctttgcaagagcaaaaaactgggtaaaagagcttcagagg
caagcaagtcctaacattgtaatagctttatcaggaaacaaggctgacctagcaaataaa
agagctgtagatttccaggaagcacagtcctatgcagatgataatagtttattattcatg
gaaacatcagctaagacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag
ttgccaaagaacgagccacagaatccaggagccaattctaccagaggaagaggagtagac
cttacggaacccacacagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system