KEGG   Loxodonta africana (African savanna elephant): 100668424
Entry
100668424         CDS       T04351                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04062  Chemokine signaling pathway
lav04217  Necroptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05140  Leishmaniasis
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05212  Pancreatic cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100668424 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100668424 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100668424 (STAT1)
   04621 NOD-like receptor signaling pathway
    100668424 (STAT1)
   04625 C-type lectin receptor signaling pathway
    100668424 (STAT1)
   04658 Th1 and Th2 cell differentiation
    100668424 (STAT1)
   04659 Th17 cell differentiation
    100668424 (STAT1)
   04062 Chemokine signaling pathway
    100668424 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100668424 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    100668424 (STAT1)
   04919 Thyroid hormone signaling pathway
    100668424 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100668424 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668424 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100668424 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100668424 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100668424 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100668424 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100668424 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100668424 (STAT1)
   05160 Hepatitis C
    100668424 (STAT1)
   05171 Coronavirus disease - COVID-19
    100668424 (STAT1)
   05164 Influenza A
    100668424 (STAT1)
   05162 Measles
    100668424 (STAT1)
   05168 Herpes simplex virus 1 infection
    100668424 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100668424 (STAT1)
   05169 Epstein-Barr virus infection
    100668424 (STAT1)
   05165 Human papillomavirus infection
    100668424 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100668424 (STAT1)
   05140 Leishmaniasis
    100668424 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100668424 (STAT1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100668424 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 BLI1
Other DBs
NCBI-GeneID: 100668424
NCBI-ProteinID: XP_010600974
LinkDB
Position
Unknown
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEVRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPILMSMIICNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETSGAAKNEQKEEQMLLQKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQARQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFTLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLTV
KVLFDKDVNERNTVKGFRKFNILGTHKKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSFSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCAQWAQLSEVLSWQFSSVTKRGLSVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPCFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHALGKYYSRPKEAPEPMELDGPRGTGYIKTELISVSEVHPSRLQTT
ENLLPMSPEEFDEVSRIVGSVEFDTMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtacgagcttcagcagcttgactccaaattcctagagcaggttcaccag
ctttatgatgacagttttcccatggaagtcagacagtacctggcccagtggctagaaaag
caagactgggagcatgctgccaacgatgtttcatttgctaccattcgttttcacgacctg
ttatcacagctggatgatcagtatagccgcttttcgttggagaacaattttttgttgcag
cataacatacggaaaagcaagcgcaatcttcaggataattttcaggaagacccaatactg
atgtctatgatcatctgtaactgtctgaaggaggaaaggaagatcctggaaaatgctcag
agatttaatcaggctcagtcagggaatattcagagcactgtgatgttagacaaacagaag
gagcttgacagcaaagtcagaaatgtgaaagacaaagttatgtgtatagagcatgaaatc
aagaccctagaagatttacaagatgaatatgactttaaatgcaaaaccttgcagaacaga
gaacatgaaaccagcggtgcggccaagaatgaacagaaagaagaacagatgttactccag
aagatgtatttaatgcttgacaataagagaaaggaagtggttcataaaataatagaattg
ttaaatgtcactgaacttacccagaatgccctcattaatgatgagcttgtggaatggaag
cggagacagcagagtgcctgtattgggggaccgcccaacgcctgccttgatcagctgcag
aactggtttaccatagttgcagagagtctacagcaggctcgtcagcagctcaaaaagctt
gaggagctggaacagaagtacacctacgagcatgaccccatcacaaaaaacaaacaagtg
ttatgggaccgcaccttcactctgttccagcagctcattcagagctcgtttgtggtggag
agacaaccttgcatgccaactcacccacagaggccactggtcctgaagactggggtccag
ttcactgtgaagttgagactgctggtgaaattacaggagctgaattataatttaacagtc
aaagtcttgtttgacaaagatgtgaatgagagaaacacagtaaagggatttagaaaattc
aacatcttgggcacacataagaaagtgatgaacatggaggaatccaccaatggaagtctg
gcagcagaatttcgacacctgcaactgaaagaacagaaaaacgctggcaccagaactaat
gagggccctctcatcgttactgaagagcttcattcctttagctttgaaacccagttgtgc
cagccgggcttggtaattgaccttgagacgacctctctgcctgttgtggtgatctccaac
gtcagccagctcccaagtggttgggcctccatcctgtggtacaacatgctggtggcagaa
cccaggaatctgtccttcttcctgaacccaccatgtgcccaatgggcgcagctttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcagtgtggaccagctgaac
atgttgggagagaagcttcttggtcctaatgctggtcccgatggtcttattccgtggacg
aggttttgtaaggaaaatatcaatgataaaaatttcccgttctggctttggattgaaagc
atccttgaactcattaaaaaacacctgctttctctctggaatgatgggtgtatcgtgggc
ttcatcagcaaggaacgagaacgcgccctgctgaaggaccagcagcctgggacgttcctg
ctgcggtttagcgagagctgccgggaaggggccatcacgttcacatgggtggagcggtcc
cagaacggaggcgaaccctgtttccatgcagttgaaccctacacaaagaaagaactttct
gccgttactttccctgatatcattcgcaattacaaagtcatggctgccgagaatattcca
gagaatcccctgaagtatttgtatccaaatattgataaagaccatgcgcttggaaagtat
tactccaggccaaaggaagcaccagaaccgatggaactcgatggtcctagaggaactgga
tacatcaagaccgagttgatttctgtgtctgaagttcacccttctagacttcagactacg
gaaaaccttctccccatgtctcctgaggagtttgatgaggtgtcgcggatagtggggtct
gtagaattcgacactatgatgaacgcagtatag

DBGET integrated database retrieval system