KEGG   Loxodonta africana (African savanna elephant): 100668498
Entry
100668498         CDS       T04351                                 

Gene name
DRD1
Definition
(RefSeq) D(1A) dopamine receptor
  KO
K04144  dopamine receptor D1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04540  Gap junction
lav04728  Dopaminergic synapse
lav05012  Parkinson disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05032  Morphine addiction
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100668498 (DRD1)
   04024 cAMP signaling pathway
    100668498 (DRD1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100668498 (DRD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100668498 (DRD1)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100668498 (DRD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100668498 (DRD1)
  09165 Substance dependence
   05030 Cocaine addiction
    100668498 (DRD1)
   05031 Amphetamine addiction
    100668498 (DRD1)
   05032 Morphine addiction
    100668498 (DRD1)
   05034 Alcoholism
    100668498 (DRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100668498 (DRD1)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    100668498 (DRD1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF621
Other DBs
NCBI-GeneID: 100668498
NCBI-ProteinID: XP_003404718
LinkDB
Position
Unknown
AA seq 446 aa
MRTLNTSTMDGTGLVVERAFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPRAAFILISLAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLD
ETMDNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKN
CQTTTGNGNPPECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGS
GETKPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKECNLVYLIPHAVDSSEDLKKEEAGGIARPLDKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaggactctgaacacctccaccatggacgggactgggctggtggtggagagggccttc
tccttccgcatcctcacagcctgcttcctgtctttgctcatcttgtccacacttttgggg
aacacactggtctgtgctgccgtcatcaggttccgacacctgcggtccaaggtgaccaac
ttctttgtcatctccttggctgtgtcagacctcctggtggctgttttggtcatgccctgg
aaggcagtggctgagattgctggcttctggccctttgggtccttctgcaacatctgggtg
gcctttgacatcatgtgctccactgcatcaatcctcaatctctgtgtgatcagtgtggac
aggtactgggctatctctagtcccttccggtatgagaggaagatgacccccagagcagca
ttcattctgatcagcttggcatggaccttgtccgtgctcatctctttcatccctgtgcag
ctcagctggcacaaggcaaaacccacaagtccctcagatgggaatgccacttccctggat
gagaccatggacaactgtgattccagcctgagcagaacatatgccatctcgtcctcccta
ataagcttttacatccctgtggccattatgattgttacgtataccaggatctacaggatc
gcccagaaacaaatacggcgcatctcggccttagagagggcggcagtacatgccaagaat
tgccagaccactacggggaatggaaacccccctgagtgctcccaaccagaaagctccttt
aagatgtccttcaaaagagagactaaagttctgaagaccctgtctgtcatcatgggagtg
tttgtgtgctgctggctgcctttcttcatcttgaactgcatggtgcccttctgtgggtct
ggagagaccaagcccttctgcattgattctatcacctttgacgtgtttgtgtggtttgga
tgggctaattcctccttgaatcccatcatctatgcctttaatgctgatttccggaaggca
ttttcaaccctcttaggatgctatcgactttgcccgacaactaacaatgccatcgagaca
gttagcatcaataacaacggggccgtggtgttttccagccatcatgagccacgaggttcc
atctccaaggagtgcaatctggtctacctaatcccacatgccgtggactcctctgaggac
ctgaagaaggaggaggcaggcggaatagccagacccttggataagctgtcccccgcccta
tctgtcatattggactatgacactgatgtctctctcgagaagattcaacccatcacgcaa
aatggacagcacccaacctga

DBGET integrated database retrieval system