KEGG   Loxodonta africana (African savanna elephant): 100668639
Entry
100668639         CDS       T04351                                 

Gene name
GNRH2
Definition
(RefSeq) progonadoliberin-2
  KO
K05252  gonadotropin-releasing hormone
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04912  GnRH signaling pathway
lav04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100668639 (GNRH2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100668639 (GNRH2)
   04912 GnRH signaling pathway
    100668639 (GNRH2)
SSDB
Motif
Pfam: GnRH
Other DBs
NCBI-GeneID: 100668639
NCBI-ProteinID: XP_023405848
LinkDB
Position
Unknown
AA seq 161 aa
MASCRLDFLLLLLLLTAHPTPSKAQHWSHGWYPGGKRASVTPWGLQLAPGLPGRVPDTAT
GSPHQTARSLPSGALTPPEDLVPWEGTAVAQPPLRGKQRLVQPLLVSRVRGPEHWNPAQT
TLATVVKGWGLCGGHETRVAGPASATCFSLPLLRPEFPREF
NT seq 486 nt   +upstreamnt  +downstreamnt
atggccagctgcaggctagacttcctcctgctgctgctgctgctgacggcccaccccaca
ccctcgaaggctcagcactggtcccatggctggtaccctggagggaagcgagcctccgtc
acaccctggggcctccagctggcccctgggctcccaggaagggtcccggacactgcaaca
ggcagcccacaccagactgcccgaagcctccccagcggtgccctgactccccctgaggac
cttgtgccctgggagggcacggccgtggctcagccgcccctccgtgggaagcagcgcctg
gtgcagcccttgttggtgagtagagtgagaggccccgagcattggaacccagcacagacc
acgctggccaccgtagttaagggctgggggctatgtggggggcatgagacacgagtggcg
ggccccgcctcggcaacctgtttctctctacccctgctgcgcccagaattcccaagagaa
ttctaa

KEGG   Loxodonta africana (African savanna elephant): 100670526
Entry
100670526         CDS       T04351                                 

Gene name
GNRH1
Definition
(RefSeq) progonadoliberin-1
  KO
K05252  gonadotropin-releasing hormone
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04912  GnRH signaling pathway
lav04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670526 (GNRH1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100670526 (GNRH1)
   04912 GnRH signaling pathway
    100670526 (GNRH1)
SSDB
Motif
Pfam: GnRH
Other DBs
NCBI-GeneID: 100670526
NCBI-ProteinID: XP_023406765
LinkDB
Position
Unknown
AA seq 127 aa
MFLRMKMVPKLLAGLILLTLCVVGCSSQHWSYGLRPGGKRNADNLIDSFQEIAKEVDQPA
EPQRFECTIHQLRSPLRDLKGALVSSSDSNTHTYVQRWKCPWYRLGQPPPIHCGAYPPDS
CDRALTG
NT seq 384 nt   +upstreamnt  +downstreamnt
atgttccttagaatgaagatggttccaaaacttctagctggacttattctgctgacttta
tgtgtggtgggctgctccagccaacactggtcctatggactgcgtcctggaggaaagaga
aacgctgacaatttgattgattctttccaagagatagccaaagaggttgatcaaccagca
gaacctcaacgctttgaatgcaccattcaccagctgcgttctccgctcagggacctgaaa
ggagctctggtgagttccagtgacagtaacacacatacgtatgttcagagatggaaatgt
ccttggtaccgcttaggacaacctcctcccattcactgcggagcctaccctcctgactcc
tgtgatagggccctcactggttag

DBGET integrated database retrieval system