KEGG   Loxodonta africana (African savanna elephant): 100669299
Entry
100669299         CDS       T04351                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04062  Chemokine signaling pathway
lav04217  Necroptosis
lav04630  JAK-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04917  Prolactin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05161  Hepatitis B
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100669299 (STAT5B)
   04630 JAK-STAT signaling pathway
    100669299 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100669299 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100669299 (STAT5B)
   04659 Th17 cell differentiation
    100669299 (STAT5B)
   04062 Chemokine signaling pathway
    100669299 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100669299 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    100669299 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669299 (STAT5B)
   05203 Viral carcinogenesis
    100669299 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100669299 (STAT5B)
   05220 Chronic myeloid leukemia
    100669299 (STAT5B)
   05223 Non-small cell lung cancer
    100669299 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100669299 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100669299 (STAT5B)
   05161 Hepatitis B
    100669299 (STAT5B)
   05162 Measles
    100669299 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100669299 (STAT5B)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100669299 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100669299
NCBI-ProteinID: XP_003414285
UniProt: G3TCH4
LinkDB
Position
Unknown
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLADVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
GNSHLEDYSSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAADGYVKPQIKQVVPEFVNASADSAG
GGATYMDQAPSPAVCAQAHYNMYPQNPDSVLDTDGDFDLDDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccagggagatgcccttcatcaaatgcaagca
ttatatggccagcattttcccatcgaggtgcggcattacttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggctgagcaccaagtgggggaagatggg
tttttactgaagatcaagctggggcactatgccacacagctccagaacacgtatgaccgc
tgccccatggagctggttcgatgcatccgccacatcttatacaatgaacagaggctggtc
cgagaagccaacaatggtagttctccagctgggagccttgccgatgccatgtcccagaaa
caccttcagatcaaccagacgtttgaggagctgcgactggtcacacaggatacagagaat
gagctgaagaagctgcagcagactcaagagtatttcatcatccaatatcaagagagcctg
aggatccaagctcagtttgcccagctggcccagctgaacccccaggagcggctgagccgg
gagacagccctccagcagaaacaggtgtcactggaagcctggctgcagcgtgaggcccag
acactacagcagtaccgtgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggacgacgagctgatccaatggaagcggaggcagcag
ctggccgggaatggagggccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagctggccgagatcatctggcagaaccggcagcagatccgcagagctgagcacctgtgc
cagcagcttcccatcccaggccccgtggaggagatgctggctgacgtcaacgccaccatc
acagacatcatctcagccctggtgaccagtacattcatcatcgagaagcagccccctcag
gtcctgaagacgcagaccaagtttgcagccacagtgcgcctgctggtaggcgggaagctg
aacgtgcacatgaaccctccccaggtgaaggcgaccatcatcagcgagcagcaggccaag
tctctgctcaaaaacgagaacacccgcaatgactacagtggggagatcttgaacaactgc
tgtgtgatggaataccaccaagccacaggcaccctcagcgcccacttcagaaacatgtcc
ctgaaacgaattaagagatctgaccgtcgaggagcagagtcagtgacagaagaaaaattt
acaatcctatttgaatcacagttcagtgttggtggaaatgagctggtttttcaggtcaag
accctgtccctcccggtggtggtgattgttcatggcagccaggacaacaatgcaacggcc
accgttctctgggacaacgcttttgcagagcctggcagggtgccatttgccgtgccggac
aaagtgctctggccgcagctgtgtgaagcactcaacatgaagttcaaggcagaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaagctgttcaacagc
ggcaacagccacctggaggactacagcagcatgtctgtgtcttggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcagtggtttgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcactggaatgatggggccattttaggttttgtgaacaag
caacaggcccacgacctactcattaacaagccagatgggaccttcctgctgagattcagc
gactctgaaatcggcggcatcaccatcgcttggaagtttgactctcaggaaagaatgttt
tggaacctgatgccttttactaccagagacttctctatccggtccctggccgaccgcttg
ggggacctgaattaccttatctacgtgtttcctgaccggcccaaagatgaagtgtactcc
aaatattacacaccagttccgtgcgagcctgccactgctaaagccgccgatggatacgtg
aagccacagatcaagcaggtggtccctgagtttgtgaatgcttctgcagactctgctggg
ggcggcgccacgtacatggaccaggccccatccccagctgtgtgcgcccaggctcactat
aacatgtatccacagaaccctgactccgtccttgacacagatggggatttcgacctggat
gacaccatggacgttgcgcggcgtgtggaggagctcttgggccgaccaatggacagtcag
tggatcccccatgcgcagtcatga

KEGG   Loxodonta africana (African savanna elephant): 100672448
Entry
100672448         CDS       T04351                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04217  Necroptosis
lav04630  JAK-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04917  Prolactin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05161  Hepatitis B
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100672448
   04630 JAK-STAT signaling pathway
    100672448
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100672448
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100672448
   04659 Th17 cell differentiation
    100672448
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100672448
   04935 Growth hormone synthesis, secretion and action
    100672448
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100672448
   05203 Viral carcinogenesis
    100672448
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100672448
   05220 Chronic myeloid leukemia
    100672448
   05223 Non-small cell lung cancer
    100672448
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100672448
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100672448
   05161 Hepatitis B
    100672448
   05162 Measles
    100672448
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100672448
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100672448
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100672448
NCBI-ProteinID: XP_010592767
LinkDB
Position
Unknown
AA seq 763 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQCSSPAGNLVDAMSQKHLQINQTFEE
LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLNPQERLSRETALQQKQVS
LEAWLQREAQTLQQYRVVSGKHQKTLQLLRTQQTIILDDELIQWKRRQQLAGNGGPPEGS
LDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLADVNATITDIISALVTST
FIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNE
CSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSVG
SNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEAL
NMKFKAEVQSNRGLTKENLVFLAQKLFNSGNSHLEDYSSMSVSWSQFNRENLPGWNYTFW
QWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAW
KFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVFSKYYTPVLAKAI
DGYVKPQIKQVVPEFVNASADSAGGSATYVDQAPSPAVCAQAHYNMYPQNPDPVLDQDGE
IDLDETMDVARHVEELLRRPMDNLGPPLAPPDGFFTAARGSLS
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ctctatgggcagcacttccccatcgaggtccgccactacttggcgcagtggattgagagc
cagccatgggatgccatcgacctagacaatccccaggaccgagcccaggccacccagctc
ctagagggcctggtgcaggagctgcagaagaaggccgagcaccaagtgggggaagatggg
tttttactgaagatcaagctggggcactatgccacacagctccagtgcagctctcctgct
gggaacctggttgatgccatgtcccagaaacaccttcagatcaaccagacatttgaggag
ctgcgactggtcacacaggatacagaaaatgagctgaagaagctgcagcagactcaagag
tatttcatcatccaatatcaagagagcctgaggatccaagctcagtttgcccagctggcc
cagctgaacccccaggagcggctgagccgggagacagccctccagcagaaacaggtgtca
ctggaagcctggctgcagcgtgaggcccagacactacagcagtaccgtgtggtgagtggg
aagcaccagaagaccctgcagctgctgcggacgcagcagaccatcatcctggacgacgag
ctgatccaatggaagcggaggcagcagctggccgggaatggagggccccccgagggcagc
ctggacgtgctgcagtcctggtgtgagaagctggccgagatcatctggcagaaccggcag
cagatccgcagagctgagcacctgtgccagcagcttcccatcccaggccccgtggaggag
atgctggctgacgtcaacgccaccatcacagacatcatctcagccctggtgaccagtaca
ttcatcatcgagaagcagccccctcaggtcctgaagacgcagaccaagtttgcagccaca
gtgcgcctgctggtaggcgggaagctgaacgtgcacatgaaccctccccaggtgaaggcg
accatcatcagcgagcagcaggccaagtctctgctcaaaaacgagaacacccgcaacgag
tgcagtggggagatcttgaacaactgctgtgtgatggaataccaccaagccacaggcacc
ctcagcgcccacttcagaaacatgtcactaaagaggatcaagcgtgctgaccggcggggc
gcagagtccgtgacggaggagaaattcacggtgctgtttgagtctcagtttagcgttggc
agcaatgagcttgtgttccaggtgaagaccctgtcccttcccgtggttgtcattgttcat
ggaagtcaggatcacaatgccactgccactgtgttgtgggacaatgcctttgctgagccg
ggcagggtgccatttgctgtgccggacaaagtgctctggccgcagctgtgtgaagcactc
aacatgaagttcaaggcagaagtgcagagcaaccggggcctgaccaaggagaacctcgtg
ttcctggcgcagaagctgttcaacagcggcaacagccacctggaggactacagcagcatg
tctgtgtcttggtcccagttcaacagggagaacttgccgggctggaactacaccttctgg
cagtggttcgacggggtgatggaggtgctaaagaagcatcacaagccccattggaatgac
ggggctatcctagggtttgtgaataagcaacaggcccatgacctgctcatcaacaagccc
gatgggaccttcttgttgcgctttagcgactcggaaatcgggggcatcaccattgcctgg
aagtttgactctcctgaccgcaacttgtggaacctgaagccgtttaccacgagggatttc
tccatccgctccctggctgaccgcctgggggacctgaactatctcatctacgtgttccct
gaccgccccaaggatgaggtcttctccaaatactacacccctgtgctagctaaagccatt
gacggatacgtgaagccacagatcaagcaagtggtccctgagtttgtgaacgcctctgca
gactctgctgggggcagcgccacgtacgtggaccaggccccgtccccagctgtgtgcgcc
caggctcactataacatgtatccacagaaccctgaccctgtcctcgaccaggatggagag
atcgatctggacgagaccatggatgttgcgaggcatgtggaggaactcctacgccgcccg
atggacaatctgggcccccctcttgctcccccagatggcttcttcaccgcagccaggggc
tcgctttcatga

DBGET integrated database retrieval system