KEGG   Loxodonta africana (African savanna elephant): 100669301
Entry
100669301         CDS       T04351                                 

Gene name
GAST
Definition
(RefSeq) gastrin
  KO
K13768  gastrin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100669301 (GAST)
SSDB
Motif
Pfam: Gastrin
Other DBs
NCBI-GeneID: 100669301
NCBI-ProteinID: XP_003414516
UniProt: G3T1F5
LinkDB
Position
Unknown
AA seq 104 aa
MQRLCVYMLIFALALASFSEAYRKPPSQMRDEFAGPMASQGLEPHWPDQLGPASHHKRQL
GSQGPSHLVADLAKKKGPWMEEEEEAYGWMDFGRRSAEEGDEHP
NT seq 315 nt   +upstreamnt  +downstreamnt
atgcagcgcctgtgtgtgtacatgctgatctttgcgctggctctggcctctttttccgaa
gcttataggaagcccccatcccagatgcgggatgaattcgcgggtcccatggcgagccag
ggcctggagccgcactggccagaccagctgggcccagcctctcatcacaaaaggcagctg
gggtcccagggcccctcacaccttgtggcagatctggccaagaagaaggggccatggatg
gaggaagaagaagaagcatatggatggatggactttggccgccgcagtgccgaggaaggg
gacgaacatccctag

DBGET integrated database retrieval system