KEGG   Loxodonta africana (African savanna elephant): 100669307
Entry
100669307         CDS       T04351                                 

Gene name
SGCB
Definition
(RefSeq) beta-sarcoglycan
  KO
K12566  beta-sarcoglycan
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100669307 (SGCB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100669307 (SGCB)
   05414 Dilated cardiomyopathy
    100669307 (SGCB)
   05416 Viral myocarditis
    100669307 (SGCB)
SSDB
Motif
Pfam: Sarcoglycan_1 CBM_6
Other DBs
NCBI-GeneID: 100669307
NCBI-ProteinID: XP_010593972
LinkDB
Position
Unknown
AA seq 297 aa
MREKAVERRNVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVIILLFILAVINLI
ITLVIWVVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLIITGNN
QPIVFQQGTTKLSVEKNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQ
KASTERITSNATSDLNIKVDGRAIVRGNEGVFIMGKTIEFRMGGNMELKAENSIILNGTV
VVSTTRLPSSSTGDQFTNGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
NT seq 894 nt   +upstreamnt  +downstreamnt
atgcgggagaaggctgttgagagacggaatgttaataaagagcacaatagtaactttaaa
gctggatatattccaatcgatgaagaccgtctccataaaacaggactaagaggaagaaag
ggcaatttagccatctgtgtgattatcctcctctttatcctggccgtcatcaatttaatt
atcacacttgttatctgggttgtgattcgcattggaccaaatggctgtgacagcatggag
tttcatgaaagtggtctgcttcgatttaagcaagtatctgacatgggagttatacatcct
ctttataagagcacagtaggaggaaggcgaaatgaaaatttgatcatcactggtaacaac
caacctattgtttttcagcaagggacaacgaagctcagcgtagagaagaacaaaacttcc
attactagtgacattggtatgcagttttttgacccaaggactcagaatattttattcagc
acagactatgaaactcatgagtttcatttgccaagtggagtgaaaagtttgaatgttcag
aaagcatctactgaaaggattaccagcaatgctactagtgatttaaatataaaagttgat
ggacgtgctatcgtgcgtggaaatgagggagtattcattatgggcaaaaccattgaattt
cgtatgggtggtaatatggaattaaaggctgaaaatagcatcatcctaaatggaactgtc
gtggtcagcacaactcgcctgcccagctcgtccactggagaccagttcactaatggtgac
tgggtacgctacaagctctgtatgtgtgctgatgggactctcttcaaagtacaagtaaca
agccagaacatgggctgccaaatctcagacaacccctgtggaaacactcattag

DBGET integrated database retrieval system